Property Summary

NCBI Gene PubMed Count 207
PubMed Score 2151.49
PubTator Score 1391.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count
Brachydactyly type E 2

Expression

  Differential Expression (15)

Disease log2 FC p
Breast cancer -2.500 2.5e-08
astrocytic glioma -1.600 1.6e-02
Astrocytoma, Pilocytic -1.100 1.8e-04
atypical teratoid / rhabdoid tumor -1.100 1.9e-02
chronic rhinosinusitis 1.541 2.1e-03
cutaneous lupus erythematosus 2.300 4.8e-03
cystic fibrosis and chronic rhinosinusit... 1.657 5.3e-03
fibroadenoma 2.100 3.1e-02
group 3 medulloblastoma 2.000 3.5e-02
lung cancer 1.100 3.1e-03
non-small cell lung cancer 2.884 6.7e-10
oligodendroglioma -1.600 2.4e-02
ovarian cancer -1.500 3.8e-05
pancreatic cancer 1.100 3.7e-03
uncontrolled asthma 1.500 9.4e-03

Gene RIF (157)

AA Sequence

MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA      1 - 70
EIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKK     71 - 140
RRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH                                     141 - 177
//

Text Mined References (209)

PMID Year Title