Property Summary

NCBI Gene PubMed Count 198
Grant Count 860
R01 Count 426
Funding $111,182,212.85
PubMed Score 2090.51
PubTator Score 1391.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession P12272 Q15251 Q6FH74 PTH-rP
Symbols HHM
PLP
BDE2
PTHR
PTHRP

Gene

PANTHER Protein Class (2)

PDB

1M5N   1BZG   1ET3   3FFD   3H3G  

Gene RIF (148)

PMID Text
26640227 we report three patients affected with brachydactyly type E, caused by PTHLH mutations expected to result in haploinsufficiency, and discuss our data compared to published reports.
26597083 TGF-beta and PTHrP were confirmed to be involved in regulating the malignant progression in breast cancer, and PTHrP expression, to be associated with bone metastasis as a potential prognostic marker in ER negative breast cancer
26562265 Data suggest affinity of ligands for binding site on PTH1R/parathyroid hormone 1 receptor, either in GTP-binding protein-dependent or -independent conformation, alters duration of action of ligand in target cells; ligands were peptide fragments of PTHRP.
25801215 A novel heterozygous mutation in PTHLH gene was identified in a Chinese pedigree with brachydactyly type E.
25539663 PTHLH/PTHrP could play a role in the pathogenesis of oral squamous cell carcinoma by affecting cell proliferation and cell cycle.
25368276 High PTHRP expression is associated with metastasis in breast cancer.
25359619 High PTHRP expression is associated with bone destruction in lung and breast cancer.
25252304 PTHLH is important during embryonic development. [review]
25053227 PTHrP regulates Caco-2 cell proliferation via several signaling pathways.
25051885 PTHrP positively modulates cell cycle progression and changes the expression of proteins involved in cell cycle regulation.
More...

AA Sequence

MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA      1 - 70
EIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKK     71 - 140
RRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH                                     141 - 177
//

Text Mined References (200)

PMID Year Title
26640227 2016 Report of two novel mutations in PTHLH associated with brachydactyly type E and literature review.
26597083 2015 Co-expression of parathyroid hormone related protein and TGF-beta in breast cancer predicts poor survival outcome.
26562265 2016 Binding Selectivity of Abaloparatide for PTH-Type-1-Receptor Conformations and Effects on Downstream Signaling.
25801215 2015 Exome sequencing reveals a novel PTHLH mutation in a Chinese pedigree with brachydactyly type E and short stature.
25539663 2014 Parathyroid hormone-related protein serves as a prognostic indicator in oral squamous cell carcinoma.
25368276 2014 Detection of circulating tumor cells in breast cancer patients using multiplex reverse transcription-polymerase chain reaction and specific primers for MGB, PTHRP and KRT19 correlation with clinicopathological features.
25359619 2014 Wnt signaling induces gene expression of factors associated with bone destruction in lung and breast cancer.
25252304 2014 [Role of parathyroid hormone-like hormone during embryonic development].
25064007 2014 A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine.
25053227 2014 Molecular mechanisms associated with PTHrP-induced proliferation of colon cancer cells.
More...