Property Summary

NCBI Gene PubMed Count 46
PubMed Score 143.37
PubTator Score 102.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
group 3 medulloblastoma 4104 3.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma -1.100 3.8e-02

Gene RIF (28)

AA Sequence

MSEGVGTFRMVPEEEQELRAQLEQLTTKDHGPVFGPCSQLPRHTLQKAKDELNEREETREEAVRELQEMV      1 - 70
QAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSPEAVRCTI     71 - 140
EAGYPGVLSSRDKYGRVVMLFNIENWQSQEITFDEILQAYCFILEKLLENEETQINGFCIIENFKGFTMQ    141 - 210
QAASLRTSDLRKMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEI    211 - 280
DENILPSDFGGTLPKYDGKAVAEQLFGPQAQAENTAF                                     281 - 317
//

Text Mined References (47)

PMID Year Title