Property Summary

NCBI Gene PubMed Count 56
PubMed Score 135.63
PubTator Score 306.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (28)

Disease log2 FC p
acute myeloid leukemia 1.700 1.3e-02
astrocytic glioma 1.100 1.1e-02
Atopic dermatitis -1.100 6.5e-05
atypical teratoid / rhabdoid tumor 1.100 2.8e-02
Breast cancer -1.100 9.4e-06
ependymoma 1.100 1.6e-02
gastric cancer -1.300 5.3e-03
Gaucher disease type 1 -1.800 1.4e-02
glioblastoma 1.100 4.8e-03
group 3 medulloblastoma 1.100 2.6e-02
intraductal papillary-mucinous adenoma (... 1.500 1.1e-02
intraductal papillary-mucinous carcinoma... 1.400 1.0e-02
lung adenocarcinoma 1.178 8.3e-03
lung cancer 1.400 2.7e-02
medulloblastoma, large-cell 2.500 1.1e-04
Multiple myeloma 1.598 7.8e-04
oligodendroglioma 1.400 7.4e-03
osteosarcoma 2.339 2.3e-07
ovarian cancer -1.100 5.8e-03
pancreatic cancer -1.200 1.2e-02
pancreatic carcinoma -1.200 1.2e-02
pancreatic ductal adenocarcinoma liver m... 2.599 8.6e-03
pediatric high grade glioma 1.400 5.9e-03
permanent atrial fibrillation -1.300 1.3e-02
Pick disease 1.800 2.3e-05
primitive neuroectodermal tumor 1.500 1.4e-04
psoriasis -1.500 8.3e-05
Waldenstrons macroglobulinemia 1.150 4.1e-02

 MGI Phenotype (1)

Gene RIF (24)

AA Sequence

MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKRLSHSQERLVN      1 - 70
ETRECQSLRLELEKLNNQLKALTEKNKELEIAQDRNIAIQSQFTRTKEELEAEKRDLIRTNERLSQELEY     71 - 140
LTEDVKRLNEKLKESNTTKGELQLKLDELQASDVSVKYREKRLEQEKELLHSQNTWLNTELKTKTDELLA    141 - 210
LGREKGNEILELKCNLENKKEEVSRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELN    211 - 280
AHIKLSNLYKSAADDSEAKSNELTRAVEELHKLLKEAGEANKAIQDHLLEVEQSKDQMEKEMLEKIGRLE    281 - 350
KELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRIN    351 - 420
KYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKQSSVLERDNRRME    421 - 490
IQVKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSYRNIEELQQQNQRLLVALREL    491 - 560
GETREREEQETTSSKITELQLKLESALTELEQLRKSRQHQMQLVDSIVRQRDMYRILLSQTTGVAIPLHA    561 - 630
SSLDDVSLASTPKRPSTSQTVSTPAPVPVIESTEAIEAKAALKQLQEIFENYKKEKAENEKIQNEQLEKL    631 - 700
QEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQDLRGA    701 - 770
NEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLSSQ    771 - 840
IEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTETNLHLNTKELLKNAQKEIATLKQHLSN    841 - 910
MEVQVASQSSQRTGKGQPSNKEDVDDLVSQLRQTEEQVNDLKERLKTSTSNVEQYQAMVTSLEESLNKEK    911 - 980
QVTEEVRKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRRAIESMEQQLSELKKTLSSVQNEVQEA    981 - 1050
LQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKA   1051 - 1120
ESQLLECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEG   1121 - 1190
KSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHE   1191 - 1260
ELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGMLQAEKKLLEE   1261 - 1330
DVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHTKRIQQLTEEIGRLKAEIARSNASLTNNQNLIQSLK   1331 - 1400
EDLNKVRTEKETIQKDLDAKIIDIQEKVKTITQVKKIGRRYKTQYEELKAQQDKVMETSAQSSGDHQEQH   1401 - 1470
VSVQEMQELKETLNQAETKSKSLESQVENLQKTLSEKETEARNLQEQTVQLQSELSRLRQDLQDRTTQEE   1471 - 1540
QLRQQITEKEEKTRKAIVAAKSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRITALKSQYEGRI   1541 - 1610
SRLERELREHQERHLEQRDEPQEPSNKVPEQQRQITLKTTPASGERGIASTSDPPTANIKPTPVVSTPSK   1611 - 1680
VTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVESQEAMQSEGPVEHVPVFGSTSGSVRS   1681 - 1750
TSPNVQPSISQPILTVQQQTQATAFVQPTQQSHPQIEPANQELSSNIVEVVQSSPVERPSTSTAVFGTVS   1751 - 1820
ATPSSSLPKRTREEEEDSTIEASDQVSDDTVEMPLPKKLKSVTPVGTEEEVMAEESTDGEVETQVYNQDS   1821 - 1890
QDSIGEGVTQGDYTPMEDSEETSQSLQIDLGPLQSDQQTTTSSQDGQGKGDDVIVIDSDDEEEDDDENDG   1891 - 1960
EHEDYEEDEEDDDDDEDDTGMGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGGEGNHR   1961 - 2030
AADSQNSGEGNTGAAESSFSQEVSREQQPSSASERQAPRAPQSPRRPPHPLPPRLTIHAPPQELGPPVQR   2031 - 2100
IQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPHRTDGFAEAIHSPQVAGVPRFRFGPPE   2101 - 2170
DMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEESGGRSVPTTPLQVAAPVTVFTESTTSDASEHASQS   2171 - 2240
VPMVTTSTGTLSTTNETATGDDGDEVFVEAESEGISSEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSS   2241 - 2310
SSVDTSSSQPKPFRRVRLQTTLRQGVRGRQFNRQRGVSHAMGGRGGINRGNIN                    2311 - 2363
//

Text Mined References (75)

PMID Year Title