Property Summary

NCBI Gene PubMed Count 56
Grant Count 88
R01 Count 64
Funding $10,772,818.14
PubMed Score 130.88
PubTator Score 306.21

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P12270 Q15624 Q15655 Q5SWY0 Q99968
Symbols

Gene

TPR

 MGI Term (1)

Gene RIF (23)

PMID Text
26094769 SLK interacts with Tpr and alpha-actinin-4 in cells, and these protein-protein interactions may control the subcellular localization and the biological activity of SLK.
25789545 Report mutual regulation between Tpr and Aurora A and further confirm the importance of nucleoporin function in spindle pole organization, bipolar spindle assembly, and mitosis.
25744187 Tpr maintains a chromatin environment favourable for HIV replication.
25731161 Knockdown of translocated promoter region (to activated MET oncogene) (TPR) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
25631074 Cellular biotinylated nucleoprotein TPR is incorporated into HIV-1 Gag virus-like particles
24938596 Protein kinase A phosphorylates the S2094 residue and that the site is hyperphosphorylated during mitosis.
24722547 analysis of interactions between CRM1 and the nuclear pore protein Tpr and snurportin
24344181 Tpr is a kinetochore-independent, rate-limiting factor required to mount and sustain a robust SAC response.
23649804 Tpr import is mediated by the most abundant import receptor, KPNA2, which binds the bipartite NLS in Tpr with nanomolar affinity
23170199 Tpr depletion increased p53 nuclear accumulation and facilitated autophagy.
More...

AA Sequence

MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKRLSHSQERLVN      1 - 70
ETRECQSLRLELEKLNNQLKALTEKNKELEIAQDRNIAIQSQFTRTKEELEAEKRDLIRTNERLSQELEY     71 - 140
LTEDVKRLNEKLKESNTTKGELQLKLDELQASDVSVKYREKRLEQEKELLHSQNTWLNTELKTKTDELLA    141 - 210
LGREKGNEILELKCNLENKKEEVSRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELN    211 - 280
AHIKLSNLYKSAADDSEAKSNELTRAVEELHKLLKEAGEANKAIQDHLLEVEQSKDQMEKEMLEKIGRLE    281 - 350
KELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRIN    351 - 420
KYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKQSSVLERDNRRME    421 - 490
IQVKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSYRNIEELQQQNQRLLVALREL    491 - 560
GETREREEQETTSSKITELQLKLESALTELEQLRKSRQHQMQLVDSIVRQRDMYRILLSQTTGVAIPLHA    561 - 630
SSLDDVSLASTPKRPSTSQTVSTPAPVPVIESTEAIEAKAALKQLQEIFENYKKEKAENEKIQNEQLEKL    631 - 700
QEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQDLRGA    701 - 770
NEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLSSQ    771 - 840
IEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTETNLHLNTKELLKNAQKEIATLKQHLSN    841 - 910
MEVQVASQSSQRTGKGQPSNKEDVDDLVSQLRQTEEQVNDLKERLKTSTSNVEQYQAMVTSLEESLNKEK    911 - 980
QVTEEVRKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRRAIESMEQQLSELKKTLSSVQNEVQEA    981 - 1050
LQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKA   1051 - 1120
ESQLLECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEG   1121 - 1190
KSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHE   1191 - 1260
ELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGMLQAEKKLLEE   1261 - 1330
DVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHTKRIQQLTEEIGRLKAEIARSNASLTNNQNLIQSLK   1331 - 1400
EDLNKVRTEKETIQKDLDAKIIDIQEKVKTITQVKKIGRRYKTQYEELKAQQDKVMETSAQSSGDHQEQH   1401 - 1470
VSVQEMQELKETLNQAETKSKSLESQVENLQKTLSEKETEARNLQEQTVQLQSELSRLRQDLQDRTTQEE   1471 - 1540
QLRQQITEKEEKTRKAIVAAKSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRITALKSQYEGRI   1541 - 1610
SRLERELREHQERHLEQRDEPQEPSNKVPEQQRQITLKTTPASGERGIASTSDPPTANIKPTPVVSTPSK   1611 - 1680
VTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVESQEAMQSEGPVEHVPVFGSTSGSVRS   1681 - 1750
TSPNVQPSISQPILTVQQQTQATAFVQPTQQSHPQIEPANQELSSNIVEVVQSSPVERPSTSTAVFGTVS   1751 - 1820
ATPSSSLPKRTREEEEDSTIEASDQVSDDTVEMPLPKKLKSVTPVGTEEEVMAEESTDGEVETQVYNQDS   1821 - 1890
QDSIGEGVTQGDYTPMEDSEETSQSLQIDLGPLQSDQQTTTSSQDGQGKGDDVIVIDSDDEEEDDDENDG   1891 - 1960
EHEDYEEDEEDDDDDEDDTGMGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGGEGNHR   1961 - 2030
AADSQNSGEGNTGAAESSFSQEVSREQQPSSASERQAPRAPQSPRRPPHPLPPRLTIHAPPQELGPPVQR   2031 - 2100
IQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPHRTDGFAEAIHSPQVAGVPRFRFGPPE   2101 - 2170
DMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEESGGRSVPTTPLQVAAPVTVFTESTTSDASEHASQS   2171 - 2240
VPMVTTSTGTLSTTNETATGDDGDEVFVEAESEGISSEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSS   2241 - 2310
SSVDTSSSQPKPFRRVRLQTTLRQGVRGRQFNRQRGVSHAMGGRGGINRGNIN                    2311 - 2363
//

Text Mined References (75)

PMID Year Title
26094769 2015 Identification of Tpr and ?-actinin-4 as two novel SLK-interacting proteins.
25789545 2015 Therapeutic potential of mitotic interaction between the nucleoporin Tpr and aurora kinase A.
25744187 2015 Chromatin organization at the nuclear pore favours HIV replication.
24970816 2014 The subcellular distribution and function of MTA1 in cancer differentiation.
24938596 2014 Phosphorylation of nucleoporin Tpr governs its differential localization and is required for its mitotic function.
24722547 2014 The interaction of CRM1 and the nuclear pore protein Tpr.
24581499 2014 Nuclear pores protect genome integrity by assembling a premitotic and Mad1-dependent anaphase inhibitor.
24344181 2013 Spindle assembly checkpoint robustness requires Tpr-mediated regulation of Mad1/Mad2 proteostasis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
More...