Property Summary

NCBI Gene PubMed Count 57
Grant Count 13
R01 Count 9
Funding $1,310,706.42
PubMed Score 85.38
PubTator Score 83.49

Knowledge Summary

Patent

No data available

Expression

Gene RIF (38)

PMID Text
25465060 The findings suggest that overexpressed IMPDH2 can be used as a biomarker for kidney and bladder cancer diagnosis and is a potential therapeutic target for the diseases
25392102 IMPDH2 is directly involved in the development of chemoresistance and radioresistance in osteosarcoma cells.
25105143 Expression of IMPDH mRNA after mycophenolate administration in male volunteers.
24980853 the localization of IMPDH2 inside the nucleus of human cells as well as the ultrastructure of R&R inclusions
24659377 Compared with non-cancerous prostate tissues, IMPDH2 mRNA and protein expression levels were both significantly upregulated in prostate cancer tissues.
24477477 Rods and rings (RR) are protein assemblies composed of CTPS1 and IMPDH2. Glutamine deprivation initiates reversible assembly of mammalian rods and rings.
23166591 Expression of HIV-1 Tat upregulates the abundance of IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2) in the nucleoli of Jurkat T-cells
22928911 An insight to the dynamics of conserved water-mediated salt bridge interaction and interdomain recognition in hIMPDH isoforms.
22066532 Role of salt bridge dynamics in inter domain recognition of human IMPDH isoforms: an insight to inhibitor topology for isoform-II.
22029192 Anti-IMPDH2 may cause difficulties in interpretation of immunofluorescence patterns in routine autoantibody testing.
More...

AA Sequence

MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPM      1 - 70
DTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFC     71 - 140
GIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLP    141 - 210
IVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNS    211 - 280
IFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKV    281 - 350
SEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM    351 - 420
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKF    421 - 490
EKRTSSAQVEGGVHSLHSYEKRLF                                                  491 - 514
//

Text Mined References (66)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25465060 2015 Elevated expression of IMPDH2 is associated with progression of kidney and bladder cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25392102 2014 IMPDH2 mediate radioresistance and chemoresistance in osteosarcoma cells.
25105143 2014 Expression of IMPDH mRNA after mycophenolate administration in male volunteers.
24980853 2014 Ultrastructure of cytoplasmic and nuclear inosine-5'-monophosphate dehydrogenase 2 "rods and rings" inclusions.
24659377 2014 Enhanced expression of IMPDH2 promotes metastasis and advanced tumor progression in patients with prostate cancer.
24477477 2014 Glutamine deprivation initiates reversible assembly of mammalian rods and rings.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...