Property Summary

NCBI Gene PubMed Count 42
Grant Count 6
R01 Count 5
Funding $1,597,585.33
PubMed Score 118.28
PubTator Score 614.27

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26842067 cancer cells require both hANT2 and hANT3, depending on their proliferation status: hANT2 when proliferation rates are high, and hANT3 when proliferation slows.
26212361 Human ANT3 expression is directly downregulated by overexpression of hcmv-miR-UL36-5p.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
19669810 The dynamics of the molecular interactions between the C-terminal region of PB1-F2 protein and VDAC1 and ANT3 were expounded by employing an in silico approach.
19111545 These data suggest that the down-regulation of ANT3 levels upon stimulation with CPT may be involved in the molecular mechanism underlying acquired resistance to camptothecin.
17855512 involvement of ANT in cell death is cell type- and stimulus-dependent
16930576 ANT3 has a potential role in T-helper cell survival and immune cell homeostasis.
16556444 Results revealed that ANT1 and ANT3 (adenine nucleotide translocase 1-3) over-expressing HeLa cells increased their atRA sensitivity.
15063741 ANT3 overexpression induces apoptosis in cultured cells.
14746803 Results demonstrate that induction of adenine nucleotide translocase 3 by interleukin-4 and interferon-gamma proceeds via pathways involving STAT6 and STAT1, respectively.
More...

AA Sequence

MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSF      1 - 70
WRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTR     71 - 140
LAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHI    141 - 210
VVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLR    211 - 280
GMGGAFVLVLYDELKKVI                                                        281 - 298
//

Text Mined References (49)

PMID Year Title
26842067 2016 Changes in the expression of the human adenine nucleotide translocase isoforms condition cellular metabolic/proliferative status.
26212361 2015 Human cytomegalovirus miR-UL36-5p inhibits apoptosis via downregulation of adenine nucleotide translocator 3 in cultured cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...