Property Summary

NCBI Gene PubMed Count 42
PubMed Score 123.85
PubTator Score 614.27

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (11)

AA Sequence

MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSF      1 - 70
WRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTR     71 - 140
LAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHI    141 - 210
VVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLR    211 - 280
GMGGAFVLVLYDELKKVI                                                        281 - 298
//

Text Mined References (49)

PMID Year Title