Property Summary

NCBI Gene PubMed Count 71
Grant Count 23
R01 Count 19
Funding $2,345,217.69
PubMed Score 110.81
PubTator Score 112.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
astrocytic glioma -2.100 0.005
ependymoma -2.600 0.000
oligodendroglioma -1.900 0.021
psoriasis -1.300 0.001
glioblastoma -3.600 0.000
medulloblastoma -2.800 0.000
atypical teratoid / rhabdoid tumor -4.000 0.000
medulloblastoma, large-cell -4.000 0.000
primitive neuroectodermal tumor -2.700 0.000
acute quadriplegic myopathy -1.144 0.000
colon cancer -1.600 0.000
lung cancer -2.000 0.000
pediatric high grade glioma -3.100 0.000
pilocytic astrocytoma -2.400 0.000
subependymal giant cell astrocytoma -2.393 0.001
lung adenocarcinoma -1.300 0.000
lung carcinoma 1.200 0.000
gastric carcinoma -1.600 0.024

Gene RIF (76)

PMID Text
26184877 Identification of ZNF555 as a putative transcriptional factor that impacts ANT1 promoter activity in facioscapulohumeral dystrophy myoblasts.
24886575 HIV-1 PR cleaves ANT in a dose-dependent manner in HEK293 cells
24884163 Data suggest acetylation of ANT1 at lysines 10/23/92 has dramatic physiological effects on ADP-ATP exchange; extent of acetylation of lysine 23 decreases following physical activity; this change is highly dependent on insulin sensitivity/resistance.
24524965 Mitochondrial DNA (mtDNA) content plays an important role in energy production and sustaining normal physiological function.
24485628 elevated ANT1 expression supports EV infection and is associated with EV persistence, a condition with adverse prognosis.
23401503 A 13-generation Mennonite pedigree with autosomal recessive myopathy and cardiomyopathy due to an SLC25A4 frameshift null mutation (c.523delC, p.Q175RfsX38), which codes for the heart-muscle isoform of the adenine nucleotide translocator-1, was studied.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
22350218 Expression of ANT1 were lower in inclusion body myositis samples versus both polymyositis and controls
22187496 This report expands the clinical spectrum of ANT1-related human diseases, and emphasises the crucial role of the mitochondrial ADP/ATP carriers in muscle function and pathophysiology of human myopathies.
21918813 HIV-1 PR cleaves ANT in a dose-dependent manner in HEK293 cells
More...

AA Sequence

MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSF      1 - 70
WRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTR     71 - 140
LAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHI    141 - 210
FVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLR    211 - 280
GMGGAFVLVLYDEIKKYV                                                        281 - 298
//

Text Mined References (74)

PMID Year Title
26184877 2015 ZNF555 protein binds to transcriptional activator site of 4qA allele and ANT1: potential implication in Facioscapulohumeral dystrophy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24884163 2014 Adenine nucleotide translocase is acetylated in vivo in human muscle: Modeling predicts a decreased ADP affinity and altered control of oxidative phosphorylation.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24524965 2014 Mitochondrial DNA content contributes to healthy aging in Chinese: a study from nonagenarians and centenarians.
24485628 2014 Adenine nucleotide translocase 1 expression affects enterovirus infection in human and murine hearts.
23401503 2013 Severity of cardiomyopathy associated with adenine nucleotide translocator-1 deficiency correlates with mtDNA haplogroup.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
22350218 2013 ANT1 is reduced in sporadic inclusion body myositis.
22187496 2012 Complete loss of expression of the ANT1 gene causing cardiomyopathy and myopathy.
More...