Property Summary

NCBI Gene PubMed Count 75
PubMed Score 114.80
PubTator Score 112.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Cardiomyopathy 116 3.457 1.7

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy -1.144 1.4e-05
adult high grade glioma -1.300 6.5e-05
astrocytic glioma -2.100 5.0e-03
Astrocytoma, Pilocytic -2.400 1.5e-07
atypical teratoid / rhabdoid tumor -1.400 2.2e-04
colon cancer -1.600 1.7e-04
ependymoma -2.300 1.3e-02
gastric carcinoma -1.600 2.4e-02
glioblastoma -2.800 2.9e-10
group 3 medulloblastoma -1.400 1.1e-02
lung adenocarcinoma -1.300 1.3e-07
lung cancer -2.000 2.7e-05
lung carcinoma 1.200 5.3e-17
malignant mesothelioma -1.500 5.4e-07
medulloblastoma, large-cell -1.500 1.1e-06
oligodendroglioma -1.900 2.1e-02
primitive neuroectodermal tumor -1.200 1.7e-04
psoriasis -1.200 1.9e-09
subependymal giant cell astrocytoma -1.536 3.1e-02

Gene RIF (70)

AA Sequence

MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSF      1 - 70
WRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTR     71 - 140
LAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHI    141 - 210
FVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLR    211 - 280
GMGGAFVLVLYDEIKKYV                                                        281 - 298
//

Text Mined References (79)

PMID Year Title