Property Summary

NCBI Gene PubMed Count 57
PubMed Score 56.43
PubTator Score 55.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.01687955120501E-18
Duchenne muscular dystrophy 602 8.45923673709016E-10
atypical teratoid / rhabdoid tumor 4369 9.97825104134016E-8
juvenile dermatomyositis 1189 2.3321797500374E-7
ovarian cancer 8492 2.78769690197534E-7
limb girdle muscular dystrophy 2A 156 2.19171563083734E-6
malignant mesothelioma 3163 7.22345775180348E-6
sonic hedgehog group medulloblastoma 1482 1.8756083263187E-5
psoriasis 6685 2.38878181854009E-5
pituitary cancer 1972 5.56640200210998E-5
Becker muscular dystrophy 187 1.28583716125329E-4
pediatric high grade glioma 2712 1.73307472481062E-4
pancreatic cancer 2300 1.94953379553712E-4
medulloblastoma, large-cell 6234 1.980875555302E-4
ulcerative colitis 2087 2.63183925222766E-4
primary pancreatic ductal adenocarcinoma 1271 2.98440198581255E-4
glioblastoma 5572 7.38431232941229E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.45753573475646E-4
osteosarcoma 7933 8.74123056181879E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 9.0779874474581E-4
primitive neuroectodermal tumor 3031 0.00386112135450067
lung adenocarcinoma 2714 0.00440091904637747
invasive ductal carcinoma 2950 0.0044999084660878
gastric carcinoma 832 0.00672022019437295
pilocytic astrocytoma 3086 0.0100756821866962
fibroadenoma 557 0.0118825811755621
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0158012395485606
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0166010431762835
interstitial lung disease 292 0.0247473124644316
Pick disease 1893 0.0432191011492757
subependymal giant cell astrocytoma 2287 0.0491062248119185
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Ullrich congenital muscular dystrophy 7 0.0 5.0
Disease Target Count Z-score Confidence
Muscular dystrophy 48 5.719 2.9
Down syndrome 548 3.44 1.7
Disease Target Count
Myosclerosis autosomal recessive 1

Expression

Synonym

Accession P12110 Q13909 Q13910 Q13911 Q14048 Q14049 Q16259 Q16597 Q6P0Q1 Q9UML3 Q9Y4S8
Symbols UCMD1
BTHLM1
PP3610

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 IMPC Term (1)

Gene RIF (21)

PMID Text
25533456 Mutations in COL6A2 gene are associated with aberrant mitochondria in Bethlem myopathy.
25204870 Parental mosaicism was confirmed in the four families through quantitative analysis of the ratio of mutant versus wild-type allele (COL6A1, COL6A2, and COL6A3) in genomic DNA from various tissues; consistent with somatic mosaicism, parental samples had lower ratios of mutant versus wild-type allele compared with the fully heterozygote offspring.
24801232 In UCMD, 8 mutations were identified in COL6A2 in Chinese patients.
24443028 Mutations in each of the three collagen VI genes, COL6A1, COL6A2 and COL6A3, cause four types of muscle disorders: Ullrich congenital muscular dystrophy, Bethlem myopathy, limb-girdle muscular dystrophy, and autosomal recessive myosclerosis. (Review)
23452080 COL6A2 is overexpressed in Down syndrome-affected umbilical cords at early and term gestational ages.
23138527 Homozygous COL6A2 mutation, p.Asp215Asn, was identified in both affected siblings. We conclude that the COL6A2 p.Asp215Asn mutation is likely to be responsible for PME (Progressive Myoclonus Epilepsy) in this family.
20302629 A deletion within intron 1A of the COL6A2 gene, occurring in compound heterozygosity with a small deletion in exon 28, was identified in a BM patient.
20106987 the C2A splice variant has a role in recessive COL6A2 C-globular missense mutations in Ullrich congenital muscular dystrophy
19698785 The alpha2(VI) chain modulates matrix-metalloproteinase (MMP) availability by sequestering proMMPs in the extracellular matrix, blocking proteolytic activity.
19309692 Four patients affected by Ullrich congenital muscular dystrophy and carrying unusual mutations of COL6 genes affecting RNA splicing, were identified.
More...

AA Sequence

MLQGTCSVLLLWGILGAIQAQQQEVISPDTTERNNNCPEKTDCPIHVYFVLDTSESVTMQSPTDILLFHM      1 - 70
KQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQVEVFSPPGSDRASFIKNLQGISSFRRGTFTDCALAN     71 - 140
MTEQIRQDRSKGTVHFAVVITDGHVTGSPCGGIKLQAERAREEGIRLFAVAPNQNLKEQGLRDIASTPHE    141 - 210
LYRNDYATMLPDSTEIDQDTINRIIKVMKHEAYGECYKVSCLEIPGPSGPKGYRGQKGAKGNMGEPGEPG    211 - 280
QKGRQGDPGIEGPIGFPGPKGVPGFKGEKGEFGADGRKGAPGLAGKNGTDGQKGKLGRIGPPGCKGDPGN    281 - 350
RGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGEIGAKGSKGYQGNSGAPGSPGVKGAKGGPGPRGPK    351 - 420
GEPGRRGDPGTKGSPGSDGPKGEKGDPGPEGPRGLAGEVGNKGAKGDRGLPGPRGPQGALGEPGKQGSRG    421 - 490
DPGDAGPRGDSGQPGPKGDPGRPGFSYPGPRGAPGEKGEPGPRGPEGGRGDFGLKGEPGRKGEKGEPADP    491 - 560
GPPGEPGPRGPRGVPGPEGEPGPPGDPGLTECDVMTYVRETCGCCDCEKRCGALDVVFVIDSSESIGYTN    561 - 630
FTLEKNFVINVVNRLGAIAKDPKSETGTRVGVVQYSHEGTFEAIQLDDERIDSLSSFKEAVKNLEWIAGG    631 - 700
TWTPSALKFAYDRLIKESRRQKTRVFAVVITDGRHDPRDDDLNLRALCDRDVTVTAIGIGDMFHEKHESE    701 - 770
NLYSIACDKPQQVRNMTLFSDLVAEKFIDDMEDVLCPDPQIVCPDLPCQTELSVAQCTQRPVDIVFLLDG    771 - 840
SERLGEQNFHKARRFVEQVARRLTLARRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTAIHEALETTQY    841 - 910
LNSFSHVGAGVVHAINAIVRSPRGGARRHAELSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDV    911 - 980
DMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIRWIC                                   981 - 1019
//

Text Mined References (62)

PMID Year Title
25533456 2015 Aberrant mitochondria in a Bethlem myopathy patient with a homozygous amino acid substitution that destabilizes the collagen VI ?2(VI) chain.
25204870 2015 Mosaicism for dominant collagen 6 mutations as a cause for intrafamilial phenotypic variability.
24801232 2014 Novel collagen VI mutations identified in Chinese patients with Ullrich congenital muscular dystrophy.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24443028 2014 Collagen type VI myopathies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23869615 2013 The expanded collagen VI family: new chains and new questions.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23452080 2013 New insights into the pathobiology of Down syndrome--hyaluronan synthase-2 overexpression is regulated by collagen VI ?2 chain.
23138527 2013 Identification of COL6A2 mutations in progressive myoclonus epilepsy syndrome.
More...