Property Summary

NCBI Gene PubMed Count 75
Grant Count 27
R01 Count 11
Funding $1,966,224.86
PubMed Score 129.50
PubTator Score 97.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma 2.200 0.000
oligodendroglioma -1.300 0.003
glioblastoma 1.700 0.004
cystic fibrosis -2.665 0.000
atypical teratoid / rhabdoid tumor 2.500 0.029
adrenocortical carcinoma 2.741 0.037
primary pancreatic ductal adenocarcinoma 3.011 0.031
non-small cell lung cancer 4.679 0.000
X-linked cerebral adrenoleukodystrophy 3.800 0.042
colon cancer 5.000 0.000
lung cancer 3.500 0.000
pancreatic cancer 3.800 0.000
breast carcinoma 3.800 0.000
Breast cancer 5.100 0.022
lung adenocarcinoma 3.100 0.000
pediatric high grade glioma 1.500 0.010
group 4 medulloblastoma -1.600 0.000
pilocytic astrocytoma 2.900 0.000
invasive ductal carcinoma 5.987 0.000
Pick disease 1.500 0.001
ductal carcinoma in situ 3.300 0.004
ovarian cancer 5.600 0.000
psoriasis -1.100 0.000

Gene RIF (46)

PMID Text
27455018 No significant association of PLEKHA7 rs11024102, COL11A1 rs3753841 and PCMTD1-ST18 rs1015213 with primary angle closure glaucoma was found among ethnic Han Chinese from Sichuan
26504042 High Col11A1 mRNA expression is associated with Adenocarcinoma of the Papilla of Vater and Pancreas Carcinoma.
26497787 Familial linkage studies for primary angle-closure glaucoma have been performed and identified MYOC causative primary angle-open-glaucoma disease
26448946 These data suggest that pro-COL11A1 expression is a highly sensitive biomarker to predict malignant relapse of intraductal papilloma.
26087191 Analysis of 104 epithelial ovarian carcinoma patients showed that high COL11A1 mRNA levels are significantly associated with poor chemoresponse and clinical outcome.
25761876 COL11A1/(pro)collagen 11A1 expression is a remarkable biomarker of human carcinoma-associated stromal cells and carcinoma progression.
25732101 This meta-analysis suggests that PLEKHA7 rs11024102 is associated with PACG (primary angle closure glaucoma) in Asian population and COL11A1 rs3753841 has a genetic association with the development of PACG both in Caucasian and Asian populations.
25511741 Studies indicate that collagen type XI alpha 1 (colXIalpha1) is overexpressed at mRNA and protein levels in many cancer types.
25417197 The immunodetection of procollagen 11A1 in cancer-associated stromal cells could be a useful biomarker for human colon adenocarcinoma characterisation.
25240749 Expanded spectrum of mutations in the COL11A1 and COL11A2 genes in Stickler syndrome.
More...

AA Sequence

MEPWSSRWKTKRWLWDFTVTTLALTFLFQAREVRGAAPVDVLKALDFHNSPEGISKTTGFCTNRKNSKGS      1 - 70
DTAYRVSKQAQLSAPTKQLFPGGTFPEDFSILFTVKPKKGIQSFLLSIYNEHGIQQIGVEVGRSPVFLFE     71 - 140
DHTGKPAPEDYPLFRTVNIADGKWHRVAISVEKKTVTMIVDCKKKTTKPLDRSERAIVDTNGITVFGTRI    141 - 210
LDEEVFEGDIQQFLITGDPKAAYDYCEHYSPDCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKE    211 - 280
AESVTEGPTVTEETIAQTEANIVDDFQEYNYGTMESYQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDS    281 - 350
QRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPPNEEFGPGVPAETDITETSINGHG    351 - 420
AYGEKGQKGEPAVVEPGMLVEGPPGPAGPAGIMGPPGLQGPTGPPGDPGDRGPPGRPGLPGADGLPGPPG    421 - 490
TMLMLPFRYGGDGSKGPTISAQEAQAQAILQQARIALRGPPGPMGLTGRPGPVGGPGSSGAKGESGDPGP    491 - 560
QGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDD    561 - 630
GMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQG    631 - 700
LPGPQGPIGPPGEKGPQGKPGLAGLPGADGPPGHPGKEGQSGEKGALGPPGPQGPIGYPGPRGVKGADGV    701 - 770
RGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVP    771 - 840
GLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSRGARGPTGKPGPKGTSGGDG    841 - 910
PPGPPGERGPQGPQGPVGFPGPKGPPGPPGKDGLPGHPGQRGETGFQGKTGPPGPGGVVGPQGPTGETGP    911 - 980
IGERGHPGPPGPPGEQGLPGAAGKEGAKGDPGPQGISGKDGPAGLRGFPGERGLPGAQGAPGLKGGEGPQ    981 - 1050
GPPGPVGSPGERGSAGTAGPIGLPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDGVQGPVGLPGPAGPAG   1051 - 1120
SPGEDGDKGEIGEPGQKGSKGDKGENGPPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGARGF   1121 - 1190
PGPPGPIGLQGLPGPPGEKGENGDVGPMGPPGPPGPRGPQGPNGADGPQGPPGSVGSVGGVGEKGEPGEA   1191 - 1260
GNPGPPGEAGVGGPKGERGEKGEAGPPGAAGPPGAKGPPGDDGPKGNPGPVGFPGDPGPPGEPGPAGQDG   1261 - 1330
VGGDKGEDGDPGQPGPPGPSGEAGPPGPPGKRGPPGAAGAEGRQGEKGAKGEAGAEGPPGKTGPVGPQGP   1331 - 1400
AGKPGPEGLRGIPGPVGEQGLPGAAGQDGPPGPMGPPGLPGLKGDPGSKGEKGHPGLIGLIGPPGEQGEK   1401 - 1470
GDRGLPGTQGSPGAKGDGGIPGPAGPLGPPGPPGLPGPQGPKGNKGSTGPAGQKGDSGLPGPPGSPGPPG   1471 - 1540
EVIQPLPILSSKKTRRHTEGMQADADDNILDYSDGMEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDL   1541 - 1610
QLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPGSWFSEFKRGKL   1611 - 1680
LSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYDNNPFI   1681 - 1750
KTLYDGCASRKGYEKTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGPVCFLG                 1751 - 1806
//

Text Mined References (77)

PMID Year Title
27455018 2016 [Association of PLEKHA7, COL11A1 and PCMTD1-ST18 gene polymorphisms with primary angle closure glaucoma in ethnic Han Chinese from Sichuan].
26504042 2015 Gene Expression of Col11A1 Is a Marker Not only for Pancreas Carcinoma But also for Adenocarcinoma of the Papilla of Vater, Discriminating Between Carcinoma and Chronic Pancreatitis.
26497787 2015 Advances in glaucoma genetics.
26448946 2015 Collagen Type XI Alpha 1 Expression in Intraductal Papillomas Predicts Malignant Recurrence.
26087191 2015 COL11A1 confers chemoresistance on ovarian cancer cells through the activation of Akt/c/EBP? pathway and PDK1 stabilization.
25761876 2015 COL11A1/(pro)collagen 11A1 expression is a remarkable biomarker of human invasive carcinoma-associated stromal cells and carcinoma progression.
25732101 2015 Genetic associations in PLEKHA7 and COL11A1 with primary angle closure glaucoma: a meta-analysis.
25511741 2015 Tumor matrix protein collagen XI?1 in cancer.
25417197 2014 Validation of COL11A1/procollagen 11A1 expression in TGF-?1-activated immortalised human mesenchymal cells and in stromal cells of human colon adenocarcinoma.
25240749 2014 Novel pathogenic COL11A1/COL11A2 variants in Stickler syndrome detected by targeted NGS and exome sequencing.
More...