Property Summary

Ligand Count 2
NCBI Gene PubMed Count 182
PubMed Score 414.87
PubTator Score 385.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.400 2.7e-07

Synonym

Accession P12104 Q2NKJ1
Symbols FABPI
I-FABP

Gene

PDB

1KZW   1KZX   2MJI   2MO5   3AKM   3IFB  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (195)

AA Sequence

MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFN      1 - 70
YNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD             71 - 132
//

Text Mined References (183)

PMID Year Title