Property Summary

NCBI Gene PubMed Count 176
Grant Count 77
R01 Count 65
Funding $7,250,964.61
PubMed Score 381.14
PubTator Score 385.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.400 0.000

Synonym

Accession P12104 Q2NKJ1
Symbols FABPI
I-FABP

Gene

PDB

1KZW   1KZX   2MJI   2MO5   3AKM   3IFB  

Gene RIF (190)

PMID Text
27110575 Urinary intestinal fatty acid-binding protein can distinguish necrotizing enterocolitis from sepsis in early stage of the disease.
26798632 I-FABP is a valid serologic biomarker for early diagnosis in NEC for the premature neonates with a moderate accuracy.
26703680 Ala54Thr polymorphism of FABP2 modulates HDL cholesterol in Mexican-Americans with type 2 diabetes.
26316042 Carriers of the Thr54 allele in FABP2 have a different metabolic response after weight loss than wild type non-A obese carriers
26238699 To determine the allele/genotype frequencies of Ala54Thr polymorphism of the FABP2 gene.
26114190 Letter: serum intestinal-fatty acid binding protein may serve as a biomarker for refractory celiac disease.
26019038 Ala54Thr polymorphism of FABP2 was associated with high triglycerides levels, but not to gallstone disease.
25847235 FABP1 and FABP2 have roles in differentially modulating the activation of PPARalpha in a ligand-selective manner
25807642 systemic marker for Crohn disease activity
25793701 Both plasma and urinary I-FABP levels specifically identify necrotizing enterocolitis in preterm infants.
More...

AA Sequence

MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFN      1 - 70
YNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD             71 - 132
//

Text Mined References (177)

PMID Year Title
27110575 2016 Urinary Intestinal Fatty Acid-Binding Protein Can Distinguish Necrotizing Enterocolitis from Sepsis in Early Stage of the Disease.
26798632 2015 Serologic Intestinal-Fatty Acid Binding Protein in Necrotizing Enterocolitis Diagnosis: A Meta-Analysis.
26703680 2015 The Ala54Thr Polymorphism of the Fatty Acid Binding Protein 2 Gene Modulates HDL Cholesterol in Mexican-Americans with Type 2 Diabetes.
26316042 2015 Role of Fatty Acid-Binding Protein 2 Ala54Thr Genotype on Weight Loss and Cardiovascular Risk Factors after a High-Protein/Low-Carbohydrate versus a Standard Hypocaloric Diet during 9 Months.
26238699 2015 The fatty acid binding protein 2 (FABP2) polymorphism Ala54Thr and obesity in Pakistan: A population based study and a systematic meta-analysis.
26114190 2015 Serum intestinal-fatty acid binding protein as a biomarker for refractory celiac disease.
26019038 Influence of ApoE and FABP2 polymorphisms and environmental factors in the susceptibility to gallstone disease.
25847235 2015 Fatty Acid-binding Proteins 1 and 2 Differentially Modulate the Activation of Peroxisome Proliferator-activated Receptor ? in a Ligand-selective Manner.
25807642 2015 Intestinal fatty acid binding protein (I-FABP) as a promising test for Crohn's disease: a preliminary study.
25793701 2015 Intestinal fatty acid-binding protein as a diagnostic marker for complicated and uncomplicated necrotizing enterocolitis: a prospective cohort study.
More...