Property Summary

NCBI Gene PubMed Count 30
Grant Count 10
R01 Count 6
Funding $2,009,399.83
PubMed Score 63.88
PubTator Score 100.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.738 0.000
acute quadriplegic myopathy 1.299 0.000
diabetes mellitus -1.200 0.001
ovarian cancer 2.800 0.000

Gene RIF (14)

PMID Text
26072516 Loss of function mutations in histidyl-tRNA synthetase cause a spectrum of inherited peripheral neuropathies
25151410 Data suggest that by comparing human and trypanosomatid histidyl-tRNA synthetases (HisRS) may provide opportunities for developing specific inhibitors of Trypanosoma brucei HisRS.
24898250 Secreted histidyl-tRNA synthetase splice variants elaborate major epitopes for autoantibodies in inflammatory myositis.
24286268 Data indicate that higher anti-Jo1 levels were associated with disease severity in antisynthetase syndrome (ASS) patients.
23422076 Non-Jo-1 anti-synAb positive patients have decreased survival compared with Jo-1 patients.
22958643 The crystal structure of a novel splice variant of a tRNA synthetase lacking the entire catalytic domain.
22930593 Findings suggest that histidyl-tRNA synthetase (HARS) is associated with axonal peripheral neuropathy.
22326685 Although anti-Jo1 positive patients with antisynthetase syndrome share features of patients with anti-PL7/PL12 antibody, they exhibit many differences regarding clinical phenotype and long-term outcome.
22279524 Study identified sequence variants in the known disease-causing genes SLC6A3 and FLVCR1, and present evidence to strongly support the pathogenicity of variants identified in TUBGCP6, BRAT1, SNIP1, CRADD, and HARS.
17785330 clinical and prognostic profiles of 45 patients displaying anti-histidyl-tRNA synthetase autoantibodies were determined
More...

AA Sequence

MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQM      1 - 70
AVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLA     71 - 140
MNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVK    141 - 210
VNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLV    211 - 280
EQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEE    281 - 350
PLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKL    351 - 420
LEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVR    421 - 490
REDLVEEIKRRTGQPLCIC                                                       491 - 509
//

Text Mined References (33)

PMID Year Title
26072516 2015 Loss of function mutations in HARS cause a spectrum of inherited peripheral neuropathies.
25151410 2014 Comparison of histidine recognition in human and trypanosomatid histidyl-tRNA synthetases.
24898250 2014 Secreted histidyl-tRNA synthetase splice variants elaborate major epitopes for autoantibodies in inflammatory myositis.
24286268 2013 Functional outcome and prognostic factors in anti-Jo1 patients with antisynthetase syndrome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23422076 2014 Patients with non-Jo-1 anti-tRNA-synthetase autoantibodies have worse survival than Jo-1 positive patients.
22958643 2012 Internally deleted human tRNA synthetase suggests evolutionary pressure for repurposing.
22930593 2013 A loss-of-function variant in the human histidyl-tRNA synthetase (HARS) gene is neurotoxic in vivo.
22326685 2012 Comparison of long-term outcome between anti-Jo1- and anti-PL7/PL12 positive patients with antisynthetase syndrome.
22279524 2012 Genetic mapping and exome sequencing identify variants associated with five novel diseases.
More...