Property Summary

NCBI Gene PubMed Count 51
Grant Count 19
R01 Count 9
Funding $2,081,853.87
PubMed Score 563.29
PubTator Score 232.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 4.900 0.000
astrocytic glioma -3.000 0.003
posterior fossa group B ependymoma -4.800 0.000
glioblastoma -3.300 0.000
oligodendroglioma -2.200 0.000
group 4 medulloblastoma -3.300 0.000
cystic fibrosis 1.340 0.000
atypical teratoid/rhabdoid tumor -4.000 0.000
primitive neuroectodermal tumor -2.400 0.001
fibroadenoma 1.900 0.022
adult high grade glioma -3.800 0.000
pilocytic astrocytoma -4.000 0.000
aldosterone-producing adenoma -1.148 0.008
severe Alzheimer's disease -1.524 0.044
Pick disease -1.100 0.026
ovarian cancer -2.700 0.001
pituitary cancer -3.800 0.000
Down syndrome -1.400 0.018

Gene RIF (29)

PMID Text
25633679 This study demonstrated that Higher NF-L concentrations (beta = -0.26) were associated with functional decline in patients with vascular burden.
25341992 Studied diagnostic Value of Serum Levels of GFAP, pNF-H, and NSE Compared With Clinical Findings in Severity Assessment of Human Traumatic Spinal Cord Injury.
25261856 Phospho-NFH levels were significantly higher in amyotrophic lateral sclerosis patients in comparison with controls, in particular in fast progressors.
25192482 pNFL-H may be useful in determining which individuals require CT imaging to assess the severity of their injury
24464810 Data identified NEFH methylation as a candidate epigenetic marker for prognosis of RCC patients as well as prediction of anti-vascular endothelial growth factor-based therapy response.
24260563 Subconcussive repetitive trauma in amateur boxing causes a mild traumatic brain injury that may be diagnosed by CSF analysis of expressed pNFH, even without unconsciousness or concussion symptoms.
23632043 CSF and intrathecal levels and CSF/serum ratios of anti-NFH antibodies were increased in the CIS patients early developing multiple sclerosis.
23134506 In conclusion, pNfH represents a promising candidate for inclusion in a panel of diagnostic and prognostic biomarkers.
23117489 These data support further study of pNF-H in CSF, serum and plasma as a potential amyotrophic lateral sclerosis biomarker
23079625 Absence of axonal neurofilaments in NFH-LacZ transgenic mice compromises axonal regeneration.
More...

AA Sequence

MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGA      1 - 70
ASSTDSLDTLSNGPEGCMVAVATSRSEKEQLQALNDRFAGYIDKVRQLEAHNRSLEGEAAALRQQQAGRS     71 - 140
AMGELYEREVREMRGAVLRLGAARGQLRLEQEHLLEDIAHVRQRLDDEARQREEAEAAARALARFAQEAE    141 - 210
AARVDLQKKAQALQEECGYLRRHHQEEVGELLGQIQGSGAAQAQMQAETRDALKCDVTSALREIRAQLEG    211 - 280
HAVQSTLQSEEWFRVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKDSLERQRSELE    281 - 350
DRHQADIASYQEAIQQLDAELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECRIGFGPIPF    351 - 420
SLPEGLPKIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEEEEKEAKEEEGKEEEGGE    421 - 490
EEEAEGGEEETKSPPAEEAASPEKEAKSPVKEEAKSPAEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKS    491 - 560
PPEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKSPAEAKSPEKAKSPVKEEAKSPAEAKSPVKEEAKSPA    561 - 630
EVKSPEKAKSPTKEEAKSPEKAKSPEKAKSPEKEEAKSPEKAKSPVKAEAKSPEKAKSPVKAEAKSPEKA    631 - 700
KSPVKEEAKSPEKAKSPVKEEAKSPEKAKSPVKEEAKTPEKAKSPVKEEAKSPEKAKSPEKAKTLDVKSP    701 - 770
EAKTPAKEEARSPADKFPEKAKSPVKEEVKSPEKAKSPLKEDAKAPEKEIPKKEEVKSPVKEEEKPQEVK    771 - 840
VKEPPKKAEEEKAPATPKTEEKKDSKKEEAPKKEAPKPKVEEKKEPAVEKPKESKVEAKKEEAEDKKKVP    841 - 910
TPEKEAPAKVEVKEDAKPKEKTEVAKKEPDDAKAKEPSKPAEKKEAAPEKKDTKEEKAKKPEEKPKTEAK    911 - 980
AKEDDKTLSKEPSKPKAEKAEKSSSTDQKDSKPPEKATEDKAAKGK                            981 - 1026
//

Text Mined References (54)

PMID Year Title
27040688 2016 Cryptic Amyloidogenic Elements in the 3' UTRs of Neurofilament Genes Trigger Axonal Neuropathy.
25633679 2015 Differential Impact of Neurofilament Light Subunit on Cognition and Functional Outcome in Memory Clinic Patients with and without Vascular Burden.
25341992 2015 Diagnostic Value of Serum Levels of GFAP, pNF-H, and NSE Compared With Clinical Findings in Severity Assessment of Human Traumatic Spinal Cord Injury.
25261856 2015 Phosphoneurofilament heavy chain and N-glycomics from the cerebrospinal fluid in amyotrophic lateral sclerosis.
25192482 2014 Detection of neurofilament-H in serum as a diagnostic tool to predict injury severity in patients who have suffered mild traumatic brain injury.
24464810 2014 Neurofilament Heavy polypeptide CpG island methylation associates with prognosis of renal cell carcinoma and prediction of antivascular endothelial growth factor therapy response.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24260563 2013 Increased CSF levels of phosphorylated neurofilament heavy protein following bout in amateur boxers.
23632043 2013 Serum and cerebrospinal fluid heavy neurofilaments and antibodies against them in early multiple sclerosis.
23134506 2013 pNfH is a promising biomarker for ALS.
More...