Property Summary

NCBI Gene PubMed Count 11
PubMed Score 126.77
PubTator Score 168.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.700 0.000

Synonym

Accession P12035 A6NIS2 Q701L8
Symbols K3
CK3

Gene

Gene RIF (3)

PMID Text
23569037 Exon sequencing of KRT3 and KRT12 in six affected and eight unaffected individuals did not detect any mutations or nucleotide sequence variants in Meesmann epithelial corneal dystrophy.
18806880 Location of the E498V mutation emphasizes the functional relevance of the highly conserved boundary motifs at the COOH-terminus of the alpha-helical rod domain in keratin 3 (K3).
16227835 A novel missense mutation (R503P) in KRT3 leads to MCD in 2 unrelated Taiwanese families.

AA Sequence

MSRQASKTSGGGSQGFSGRSAVVSGSSRMSCVAHSGGAGGGAYGFRSGAGGFGSRSLYNLGGNKSISISV      1 - 70
AAGGSRAGGFGGGRSSCAFAGGYGGGFGSGYGGGFGGGFGGGRGMGGGFGGAGGFGGAGGFGGAGGFGGP     71 - 140
GGFGGSGGFGGPGSLGSPGGFGPGGFPGGIQEVTINQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFA    141 - 210
SFIDKVRFLEQQNKVLETKWNLLQQQGTSSISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNME    211 - 280
DLVEDFKKKYEDEINKRTAAENEFVTLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAELSQMQSHI    281 - 350
SDTSVVLSMDNNRSLDLDSIIAEVRAQYEDIAQRSKAEAEALYQTKLGELQTTAGRHGDDLRNTKSEIIE    351 - 420
LNRMIQRLRAEIEGVKKQNANLQTAIAEAEQHGEMALKDANAKLQELQAALQQAKDDLARLLRDYQELMN    421 - 490
VKLALDVEIATYRKLLEGEEYRMSGECPSAVSISVVSSSTTSASAGGYGGGYGGGMGGGLGGGFSAGGGS    491 - 560
GSGFGRGGGGGIGGGFGGGSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR      561 - 628
//

Text Mined References (12)

PMID Year Title
23569037 2013 Autosomal-dominant Meesmann epithelial corneal dystrophy without an exon mutation in the keratin-3 or keratin-12 gene in a Chinese family.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
18806880 2008 Genetics of Meesmann corneal dystrophy: a novel mutation in the keratin 3 gene in an asymptomatic family suggests genotype-phenotype correlation.
16831889 2006 New consensus nomenclature for mammalian keratins.
16541075 2006 The finished DNA sequence of human chromosome 12.
16227835 2005 Novel mutations in the helix termination motif of keratin 3 and keratin 12 in 2 Taiwanese families with Meesmann corneal dystrophy.
15737194 2005 Characterization of new members of the human type II keratin gene family and a general evaluation of the keratin gene domain on chromosome 12q13.13.
9171831 1997 Mutations in cornea-specific keratin K3 or K12 genes cause Meesmann's corneal dystrophy.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7510223 1994 Assignment of the human cytokeratin 3 gene (KRT3) to 12q12-->q13 by FISH.
More...