Property Summary

NCBI Gene PubMed Count 48
Grant Count 13
R01 Count 6
Funding $3,350,823.66
PubMed Score 99.85
PubTator Score 63.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -4.900 0.000
Hydrolethalus syndrome 1.725 0.029

 OMIM Term (1)

Gene RIF (18)

PMID Text
25998163 These findings collectively demonstrate a tumor suppressor role of miR-188-5p in HCC progression via targeting FGF5
25618516 High BMI increases the effect of the blood pressure-increasing allele at rs1458038 near FGF5 in a Chinese population.
24989505 FGF5 is a crucial regulator of hair growth in humans.
23759979 In Chinese children, no association of CSK rs1378942, MTHFR rs1801133, CYP17A1 rs1004467, STK39 rs3754777 and FGF5 rs16998073 with BP/risk of hypertension.
22959498 Meta-analysis indicated significant associations of both CYP17A1 rs11191548 and FGF5 rs16998073 polymorphisms with hypertension susceptibility in East Asians.
21045733 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20852445 Variants in or near FGF5, CYP17A1 and MTHFR contributed to variation in BP and hypertension risk. Effect sizes of these three loci tended to be larger in Chinese than in white Europeans
20852445 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQ      1 - 70
GSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNK     71 - 140
FLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQH    141 - 210
ISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG                211 - 268
//

Text Mined References (50)

PMID Year Title
25998163 2015 MicroRNA-188-5p suppresses tumor cell proliferation and metastasis by directly targeting FGF5 in hepatocellular carcinoma.
25618516 2015 Variant Near FGF5 Has Stronger Effects on Blood Pressure in Chinese With a Higher Body Mass Index.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
24989505 2014 FGF5 is a crucial regulator of hair length in humans.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
23759979 2014 Association of common variants in/near six genes (ATP2B1, CSK, MTHFR, CYP17A1, STK39 and FGF5) with blood pressure/hypertension risk in Chinese children.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22959498 2013 Recapitulation of four hypertension susceptibility genes (CSK, CYP17A1, MTHFR, and FGF5) in East Asians.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
More...