Property Summary

NCBI Gene PubMed Count 20
Grant Count 42
R01 Count 35
Funding $3,558,607.28
PubMed Score 210.10
PubTator Score 58.63

Knowledge Summary

Patent

No data available

Gene RIF (5)

PMID Text
23881307 VPREB1 focal deletions are common in B-ALL and occur independent of V(D)J light chain recombination. Focal deletions of VPREB1 correlate with decreased expression levels and high-risk patients with focal deletions tend to have poorer overall survival
21144590 The proportion of the individuals with <2 copies of the VPREB1 gene was significantly higher in the patient group than that in the controls, while that of the individuals with >2 copies was lower in the patient group than that in the controls.
20237496 Observational study of gene-disease association. (HuGE Navigator)
16818733 Pre-B cell integrins and their stromal cell ligands together with the pre-B cell receptor and galectin-1 form a homogeneous lattice at the contact area between bone marrow pre-B and stromal cells.
11994467 The 5' region of the VpreB gene contains a promoter which displays higher relative activity in preB cells compared with cells at other stages or from other lineages.

AA Sequence

MSWAPVLLMLFVYCTGCGPQPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLR      1 - 70
YFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAA     71 - 140
RTRVP                                                                     141 - 145
//

Text Mined References (24)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23881307 2014 VPREB1 deletions occur independent of lambda light chain rearrangement in childhood acute lymphoblastic leukemia.
21269460 2011 Initial characterization of the human central proteome.
21144590 2011 The potential role of VPREB1 gene copy number variation in susceptibility to rheumatoid arthritis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18287279 2008 Engineering and characterization of a single chain surrogate light chain variable domain.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17431183 2007 Structural insight into pre-B cell receptor function.
16818733 2006 Clustering of pre-B cell integrins induces galectin-1-dependent pre-B cell receptor relocalization and activation.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
More...