Property Summary

NCBI Gene PubMed Count 21
PubMed Score 220.20
PubTator Score 58.63

Knowledge Summary

Patent

No data available

Gene RIF (6)

AA Sequence

MSWAPVLLMLFVYCTGCGPQPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLR      1 - 70
YFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAA     71 - 140
RTRVP                                                                     141 - 145
//

Text Mined References (25)

PMID Year Title