Property Summary

NCBI Gene PubMed Count 453
Grant Count 100
R01 Count 66
Funding $8,976,140.84
PubMed Score 11.53
PubTator Score 4332.84

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P12004 B2R897 D3DW02 PCNA
Symbols ATLD2

Gene

PDB

1U7B   1UL1   5E0V   4ZTD   3P87   1AXC   1U76   1VYJ   1VYM   1W60   2ZVK   2ZVL   2ZVM   3JA9   3TBL   3VKX   3WGW   4D2G   4RJF   5E0T   5E0U   5IY4  

Gene RIF (308)

PMID Text
26731993 data indicated that IncRNA-PCNA-AS1 may participate in the gastric cancer carcinogenesis and development and may serve as a new biomarker for patients with gastric cancer
26688547 The authors describe the structure of the disease-causing S228I variant, which reveals a large conformational change that dramatically transforms the binding pocket for PCNA client proteins.
26673319 USP7 suppresses H2O2-induced mutagenesis involving cell-cycle-independent processes such as DNA repair.
26557712 Effect of Fenugreek seed extract (FCE) was studied using HepG2 cell line; evaluated apoptosis effect and changes in expression of PCNA and tp53 due to FCE.
26450907 Studies show that acidic residue methyltransferase 1 (Armt1) has a vital role in regulation of the DNA damage response likely through its ability to O-methylate glutamyl residues of the DNA repair factor proliferating cell nuclear antigen (PCNA).
26408825 Hydrophobic pocket of PCNA is the key domain mediating ALKBH2/PCNA interaction. PCNA association with ALKBH2 increases significantly during DNA replication, suggesting that ALKBH2 forms a cell-cycle dependent complex with PCNA.
26377631 adenine glycosylase activity, mismatch recognition properties and interaction with protein partners of MUTYH and 5 MAP variants were examined; P502L and R520Q had reduced affinity for PCNA; only Q324H was found to have reduced affinity for Hus1
26339416 Report PCNA expression in giant cell tumor of bones.
26223641 Bub1 in complex with LANA recruits PCNA to regulate Kaposi's sarcoma-associated herpesvirus latent replication and DNA translesion synthesis.
26117423 The expression of BAF180 promotes UV-induced PCNA ubiquitination during S phase.
More...

AA Sequence

MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGV      1 - 70
NLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMP     71 - 140
SGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALR    141 - 210
YLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS                       211 - 261
//

Text Mined References (467)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26731993 2015 High Expression of IncRNA-PCNA-AS1 in Human Gastric Cancer and its Clinical Significances.
26688547 2016 A Disease-Causing Variant in PCNA Disrupts a Promiscuous Protein Binding Site.
26673319 2015 USP7 Is a Suppressor of PCNA Ubiquitination and Oxidative-Stress-Induced Mutagenesis in Human Cells.
26557712 2015 Trigonella foenum (Fenugreek) Induced Apoptosis in Hepatocellular Carcinoma Cell Line, HepG2, Mediated by Upregulation of p53 and Proliferating Cell Nuclear Antigen.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26450907 2015 Armt1: a phoenix rises from the ashes.
26408825 2015 The interaction between ALKBH2 DNA repair enzyme and PCNA is direct, mediated by the hydrophobic pocket of PCNA and perturbed in naturally-occurring ALKBH2 variants.
26377631 2015 Distinct functional consequences of MUTYH variants associated with colorectal cancer: Damaged DNA affinity, glycosylase activity and interaction with PCNA and Hus1.
26339416 2015 Expression of CD147, PCNA, VEGF, MMPs and their clinical significance in the giant cell tumor of bones.
More...