Property Summary

NCBI Gene PubMed Count 131
Grant Count 112
R01 Count 77
Funding $14,172,718.85
PubMed Score 344.14
PubTator Score 226.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.500 0.005
Duchenne muscular dystrophy 1.422 0.000
juvenile dermatomyositis 1.077 0.000
acute quadriplegic myopathy 1.615 0.000
lung cancer -3.100 0.044
spina bifida -1.094 0.026
ovarian cancer 2.700 0.000
Down syndrome 1.100 0.000

Synonym

Accession P11940 Q15097 Q93004 PABP-1
Symbols PAB1
PABP
PABP1
PABPC2
PABPL1

Gene

PDB

5DX1   5DX8   5DXA   2X04   3KTP   3KUI   3KTR   3PKN   1JH4   3KUJ   3PTH   1CVJ   1G9L   1JGN   2K8G   2RQG   2RQH   3KUR   3KUS   3KUT   4F02   4F25   4F26  

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
2014 confirmatory 2985 / 2226 / 285864 uHTS fluorescence polarization assay for the identification of translation initiation inhibitors (PABP)
2030 summary 0 / 0 / 0 Summary assay for the identification of translation initiation inhibitors (PABP)
435018 confirmatory 24 / 0 / 61 SAR analysis for the identification of translation initiation inhibitors (PABP)
449751 confirmatory 2 / 0 / 0 SAR analysis for the identification of translation initiation inhibitors (PABP) via an Electrophoretic Mobility Shift Dose Response Assay
449752 screening 4 / 0 / 21 SAR analysis for the identification of translation initiation inhibitors (PABP) via an Electrophoretic Mobility Shift Assay
588489 screening 1308 / 0 / 358213 uHTS identification of microRNA-mediated mRNA deadenylation inhibitors by fluoresence polarization assay
588500 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of microRNA-mediated mRNA deadenylation
602259 confirmatory 11 / 0 / 1175 Dose-response confirmation of microRNA-mediated mRNA deadenylation inhibitors by fluoresence polarization assay
602260 confirmatory 0 / 0 / 1186 Dose-response secondary confirmation of microRNA-mediated mRNA deadenylation inhibitors by fluoresence polarization assay using Cy5 labeled peptide

Gene RIF (69)

PMID Text
26912148 BTG2 stimulates mRNA deadenylation via CAF1 activation through interaction with PABPC1. Interaction of BTG2 with the first RRM domain of PABPC1 is required for BTG2 to control cell proliferation.
26188282 PABPC1 interacts with AGO2 and is responsible for the microRNA mediated gene silencing in high grade hepatocellular carcinoma.
26176602 PABPC1 is a novel co-regulator of the AR
26097561 PABPC1 is upregulated in gastric carcinoma tissues, and high PABPC1 expression predicts poor survival. PABPC1 regulates proliferation and transformation of gastric cancer cells in vitro and in vivo. PABPC1 knockdown induces apoptosis.
25503397 Poly(A) binding protein 1 enhances cap-independent translation initiation of neurovirulence factor from avian herpesvirus
25496916 Poly(A) binding protein, cytoplasmic 1 (PABPC1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25111021 This study highlights PABP-1 as a protein that is important to the pathology of ALS and indicates that the proteomic profile of TDP-43 inclusions in ALS may differ depending on the causative genetic mutation.
25065644 Metastatic duodenal cancer cells do not tolerate intracellular PABP1 accumulation and are thus exported into the extracellular milieu by the exosome-mediated pathway. In addition, PABP1 has a potential use as a biomarker for metastatic duodenal cancer.
24336168 PABPC1 is mislocalized in spinal cord motor neurons in amyotrophic lateral sclerosis.
23966414 These results suggest that production of the NSs protein during rift valley fever virus infection leads to sequestration of PABP1 in the nuclear speckles, creating a state within the cell that favors viral protein production.
More...

AA Sequence

MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALD      1 - 70
TMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGY     71 - 140
GFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDL    141 - 210
FGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKF    211 - 280
EQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAV    281 - 350
TEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA    351 - 420
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTM    421 - 490
GPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQ    491 - 560
MLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSA    561 - 630
TGVPTV                                                                    631 - 636
//

Text Mined References (148)

PMID Year Title
26912148 2016 BTG2 bridges PABPC1 RNA-binding domains and CAF1 deadenylase to control cell proliferation.
26735137 2016 Characterization of RyDEN (C19orf66) as an Interferon-Stimulated Cellular Inhibitor against Dengue Virus Replication.
26188282 2015 PABPC1 interacts with AGO2 and is responsible for the microRNA mediated gene silencing in high grade hepatocellular carcinoma.
26176602 2015 Poly (A) Binding Protein Cytoplasmic 1 Is a Novel Co-Regulator of the Androgen Receptor.
26097561 2015 PABPC1 exerts carcinogenesis in gastric carcinoma by targeting miR-34c.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25503397 2014 Poly(A) binding protein 1 enhances cap-independent translation initiation of neurovirulence factor from avian herpesvirus.
25480299 2014 Uridylation by TUT4 and TUT7 marks mRNA for degradation.
25111021 2014 Poly-A binding protein-1 localization to a subset of TDP-43 inclusions in amyotrophic lateral sclerosis occurs more frequently in patients harboring an expansion in C9orf72.
25065644 2014 Exosome-mediated extracellular release of polyadenylate-binding protein 1 in human metastatic duodenal cancer cells.
More...