Property Summary

NCBI Gene PubMed Count 80
Grant Count 394
R01 Count 277
Funding $50,738,208.39
PubMed Score 2473.47
PubTator Score 1798.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Synonym

Accession P11926 Q53TU3 Q6LDS9 ODC
Symbols ODC

Gene

PANTHER Protein Class (2)

PDB

1D7K   2ON3   2OO0   4ZGY   5BWA  

Gene RIF (52)

PMID Text
26460945 High ODC expression is associated with Medulloblastoma.
26305948 Data show the the interplay between the enzyme ornithine decarboxylase (ODC) and two regulatory proteins: antizyme (Az) and inhibitor (AzIN).
26178413 Bag-1 indirectly affects cell survival through c-Myc activated signalling that causes elevation of ornithine decarboxylase levels, leading to an increase of the polyamine content.
26172301 mechanistic study of the molecular interactions between antizyme inhibitor and its interacting proteins CCND1 and ornithine decarboxylase
26140984 Data suggest that down-regulation of ODC (using siRNA or pharmacologic inhibitor) in bone marrow-derived mesenchymal stem cells results in reduced intracellular polyamines (putrescine, spermidine, and spermine) and enhanced osteogenesis.
26093909 We earlier presented evidence for a physical interaction between ODC and SPR and we showed that RNAi-mediated knockdown of SPR expression significantly reduced native ODC enzyme activity and impeded Neuroblastoma cell proliferation.
24386364 BTF3, HINT1, NDRG1 and ODC1 protein over-expression in human prostate cancer tissue
24260338 Akt activation by ODC+COX-2 over-expression.
24096079 Authors identified SPR as a novel regulator of ODC enzyme activity and, based on clinical evidence, present a model in which SPR drives ODC-mediated malignant progression in neuroblastoma.
24002681 ODC overexpression suppresses the expression of tumstatin, which may provide fundamental evidence for the combination of anti-angiogenic therapy and conventional therapy for cancer treatment.
More...

AA Sequence

MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKC      1 - 70
NDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELM     71 - 140
KVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQ    141 - 210
AISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYV    211 - 280
ASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKY    281 - 350
YSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF    351 - 420
QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV                                 421 - 461
//

Text Mined References (84)

PMID Year Title
26460945 2015 Non-canonical Hedgehog/AMPK-Mediated Control of Polyamine Metabolism Supports Neuronal and Medulloblastoma Cell Growth.
26305948 2015 Structural basis of antizyme-mediated regulation of polyamine homeostasis.
26178413 2015 Bag-1 promotes cell survival through c-Myc-mediated ODC upregulation that is not preferred under apoptotic stimuli in MCF-7 cells.
26172301 2015 Multifaceted interactions and regulation between antizyme and its interacting proteins cyclin D1, ornithine decarboxylase and antizyme inhibitor.
26140984 2015 Suppression of ornithine decarboxylase promotes osteogenic differentiation of human bone marrow-derived mesenchymal stem cells.
26093909 2015 Effect of sulfasalazine on human neuroblastoma: analysis of sepiapterin reductase (SPR) as a new therapeutic target.
25416956 2014 A proteome-scale map of the human interactome network.
24386364 2013 Quantitative analysis of BTF3, HINT1, NDRG1 and ODC1 protein over-expression in human prostate cancer tissue.
24260338 2013 Inhibiting cycloxygenase and ornithine decarboxylase by diclofenac and alpha-difluoromethylornithine blocks cutaneous SCCs by targeting Akt-ERK axis.
24096079 2014 Novel interaction of ornithine decarboxylase with sepiapterin reductase regulates neuroblastoma cell proliferation.
More...