Property Summary

Ligand Count 4
NCBI Gene PubMed Count 84
PubMed Score 2514.88
PubTator Score 1798.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count
Carcinoma of colon 32

Expression

  Differential Expression (26)

Disease log2 FC p
acute quadriplegic myopathy 1.278 5.3e-06
astrocytoma 1.200 3.4e-15
atypical teratoid / rhabdoid tumor 1.500 5.8e-07
Barrett's esophagus 2.100 1.5e-02
chronic rhinosinusitis -1.376 7.4e-03
colon cancer 1.900 4.6e-02
cutaneous lupus erythematosus 1.300 2.8e-03
dermatomyositis 1.200 1.5e-02
diabetes mellitus -1.100 2.0e-02
ependymoma 1.600 4.0e-14
esophageal adenocarcinoma 1.400 3.4e-02
glioblastoma 1.500 2.4e-08
group 3 medulloblastoma 2.500 5.5e-08
invasive ductal carcinoma -1.269 5.3e-04
lung cancer 4.400 2.5e-07
medulloblastoma, large-cell 2.400 7.0e-08
Multiple myeloma 1.632 8.0e-03
oligodendroglioma 1.300 2.0e-11
ovarian cancer -1.600 2.5e-03
pancreatic ductal adenocarcinoma liver m... -1.230 3.3e-02
pediatric high grade glioma 1.500 5.1e-06
pituitary cancer -1.300 1.6e-06
primitive neuroectodermal tumor 1.900 1.5e-06
psoriasis 2.500 7.1e-04
spina bifida -1.391 4.6e-02
ulcerative colitis 1.300 2.6e-06

Protein-protein Interaction (1)

Gene RIF (56)

AA Sequence

MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKC      1 - 70
NDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELM     71 - 140
KVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQ    141 - 210
AISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYV    211 - 280
ASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKY    281 - 350
YSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF    351 - 420
QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV                                 421 - 461
//

Text Mined References (90)

PMID Year Title