Property Summary

NCBI Gene PubMed Count 62
PubMed Score 27478.18
PubTator Score 1341.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
periodontitis 269 9.1729768065522E-30
non-small cell lung carcinoma 413 1.34563675145905E-15
lung adenocarcinoma 2714 2.54217514552338E-11
osteosarcoma 7933 4.73583562422883E-5
interstitial cystitis 2299 0.00280890770646112
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00517045333275549
ulcerative colitis 2087 0.00643630173461174
cystic fibrosis and chronic rhinosinusitis 213 0.0234906425329452
chronic rhinosinusitis 512 0.0271128668106737
cutaneous lupus erythematosus 1056 0.0372721365097615
gastric cancer 436 0.0425564969158161
Disease Target Count Z-score Confidence
Celiac disease 112 7.535 3.8
Immunoglobulin alpha deficiency 10 7.301 3.7
Kidney disease 397 6.907 3.5
Henoch-Schoenlein purpura 13 6.696 3.3
Dermatitis 141 6.262 3.1
Cancer 2346 5.978 3.0
Diarrhea 155 5.908 3.0
Influenza 142 5.849 2.9
Vasculitis 64 5.814 2.9
Lupus erythematosus 80 5.766 2.9
Purpura 17 5.705 2.9
Bullous pemphigoid 17 5.671 2.8
Rheumatoid Arthritis 1171 5.602 2.8
Allergic hypersensitivity disease 123 5.6 2.8
Epidermolysis bullosa acquisita 10 5.505 2.8
Anemia 252 5.447 2.7
Toxoplasmosis 16 5.431 2.7
Cholera 33 5.425 2.7
Tetanus 66 5.387 2.7
Inflammatory bowel disease 142 5.347 2.7
Pneumonia 133 5.297 2.6
Liver disease 219 5.215 2.6
Pertussis 17 5.173 2.6
Chlamydia 18 5.171 2.6
Dental caries 67 5.143 2.6
Otitis media 32 5.125 2.6
Gastroenteritis 46 5.003 2.5
Heavy chain disease 6 4.981 2.5
Tonsillitis 18 4.868 2.4
Giardiasis 10 4.839 2.4
Diphtheria 23 4.799 2.4
Typhoid fever 22 4.776 2.4
Bronchitis 44 4.752 2.4
Acquired immunodeficiency syndrome 164 4.697 2.3
Asthma 349 4.645 2.3
Ankylosing spondylitis 138 4.638 2.3
Macroglobulinemia 17 4.637 2.3
Periodontal disease 37 4.633 2.3
Exanthem 39 4.619 2.3
Cryoglobulinemia 15 4.616 2.3
Gastritis 44 4.561 2.3
tuberculosis 1563 4.508 2.3
Infectious mononucleosis 15 4.488 2.2
POEMS syndrome 6 4.438 2.2
Autoimmune hemolytic anemia 17 4.416 2.2
Dysentery 13 4.395 2.2
Eye disease 55 4.386 2.2
Rubella 14 4.385 2.2
Antiphospholipid syndrome 18 4.377 2.2
Reactive arthritis 7 4.341 2.2
Shigellosis 16 4.299 2.1
Polyneuropathy 30 4.294 2.1
Rhinitis 46 4.268 2.1
Infertility 163 4.231 2.1
Sinusitis 30 4.201 2.1
Amebiasis 22 4.2 2.1
Schistosomiasis 38 4.194 2.1
Amyloidosis 68 4.175 2.1
Meningitis 46 4.169 2.1
Thrombocytopenia 105 4.147 2.1
Bronchiectasis 29 4.145 2.1
Leukopenia 42 4.143 2.1
Chickenpox 6 4.139 2.1
Hypertension 293 4.132 2.1
diabetes mellitus 1663 4.086 2.0
interstitial lung disease 292 4.075 2.0
Eosinophilia 65 4.071 2.0
Measles 20 4.067 2.0
Neuropathy 210 4.054 2.0
Inclusion conjunctivitis 8 4.042 2.0
Dysgammaglobulinemia 9 4.016 2.0
Mumps 10 4.009 2.0
X-linked hyper IgM syndrome 5 3.91 2.0
Candidiasis 48 3.905 2.0
Cryptosporidiosis 12 3.898 1.9
Lymphadenitis 12 3.882 1.9
Herpes simplex 19 3.879 1.9
Q fever 11 3.854 1.9
Hepatitis B 103 3.851 1.9
Brucellosis 24 3.827 1.9
Sjogren's syndrome 23 3.819 1.9
Guillain-Barre syndrome 15 3.811 1.9
Brain disease 84 3.797 1.9
Lichen planus 17 3.791 1.9
Prostatitis 15 3.774 1.9
Ataxia telangiectasia 32 3.764 1.9
Acute cystitis 37 3.75 1.9
Syphilis 18 3.733 1.9
psoriasis 6685 3.73 1.9
Polyclonal hypergammaglobulinemia 5 3.72 1.9
Urethritis 10 3.707 1.9
Heart disease 279 3.683 1.8
Collagen disease 25 3.652 1.8
sarcoidosis 368 3.604 1.8
Aspergillosis 23 3.603 1.8
Strongyloidiasis 9 3.603 1.8
Autoimmune thyroiditis 24 3.592 1.8
Meningoencephalitis 13 3.576 1.8
Cholangitis 20 3.569 1.8
Coronary artery disease 240 3.568 1.8
Erythema multiforme 15 3.557 1.8
Stomatitis 19 3.538 1.8
Autoimmune hepatitis 13 3.532 1.8
Leprosy 77 3.532 1.8
Rheumatic disease 9 3.532 1.8
Urticaria 53 3.532 1.8
Irritable bowel syndrome 59 3.515 1.8
cystic fibrosis 1670 3.473 1.7
Multiple Sclerosis 498 3.469 1.7
Parotitis 6 3.431 1.7
Herpes gestationis 5 3.422 1.7
Atherosclerosis 275 3.417 1.7
Autoimmune thrombocytopenic purpura 14 3.416 1.7
Dyspepsia 34 3.411 1.7
Trichomoniasis 9 3.408 1.7
Bacteriuria 13 3.39 1.7
Hepatitis A 10 3.368 1.7
Cervicitis 6 3.331 1.7
Herpes zoster 7 3.325 1.7
Bronchiolitis 9 3.293 1.6
Down syndrome 548 3.278 1.6
Echinococcosis 28 3.275 1.6
Arthropathy 34 3.27 1.6
Common cold 63 3.256 1.6
Salpingitis 6 3.252 1.6
Cholestasis 93 3.215 1.6
Myositis 24 3.214 1.6
Goodpasture syndrome 6 3.211 1.6
Duodenitis 8 3.195 1.6
Pneumocystosis 18 3.176 1.6
Vaginitis 4 3.154 1.6
Poliomyelitis 11 3.144 1.6
Lymphogranuloma venereum 10 3.128 1.6
Paratyphoid fever 10 3.121 1.6
Graves' disease 25 3.102 1.6
Newcastle disease 13 3.1 1.6
Rheumatic fever 16 3.085 1.5
Wiskott-Aldrich syndrome 27 3.083 1.5
Monoclonal paraproteinemia 2 3.077 1.5
protein-energy malnutrition 8 3.077 1.5
Duodenal ulcer 20 3.066 1.5
Pelvic inflammatory disease 21 3.063 1.5
Pharyngitis 17 3.055 1.5
Intussusception 5 3.054 1.5
Leishmaniasis 49 3.044 1.5
Chronic fatigue syndrome 29 3.039 1.5
Severe Combined Immunodeficiency 46 3.016 1.5

Expression

Synonym

Accession P11912 A0N775 Q53FB8
Symbols IGA
MB-1

Gene

PDB

1CV9  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid

Gene RIF (22)

PMID Text
26540570 Data show that Bruton tyrosine kinase (BTK)inhibitor Ibrutinib augments MALT lymphoma associated translocation protein (MALT1) inhibition by S-Mepazine in CD79 antigen mutant activated B cell-subtype (ABC) of diffuse large B cell lymphoma (DLBCL).
24974109 High intensity of caries is associated with increased levels of some salivary components - sIgA, histatin-5 and lactoperoxidase.
24769851 Phosphorylation of CD79a causes a decrease in helical propensity in the C-terminal region, for CD79b, the opposite was observed and phosphorylation resulted in an increase of helical propensity in the C-terminal part.
24162774 HIV-1 gp120 upregulates the expression of CD79a molecule, immunoglobulin-associated alpha (CD79A) in human B cells
24146823 CD79a plays a functional role in the tumor promoting effects of myeloid cells, and may represent a novel target for cancer therapy.
21324920 STN produced significant antitumor effects in a mouse xenograft model of CD79A/B-mutated DLBCL.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20102401 CD79a may be helpful marker in the differential diagnosis of classical Hodgkin's lymphoma and primary mediastinal B-cell lymphoma
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVL      1 - 70
HGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGT     71 - 140
KNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTY    141 - 210
QDVGSLNIGDVQLEKP                                                          211 - 226
//

Text Mined References (67)

PMID Year Title
26540570 2015 Combinatorial BTK and MALT1 inhibition augments killing of CD79 mutant diffuse large B cell lymphoma.
25416956 2014 A proteome-scale map of the human interactome network.
24974109 2014 The assessment of sIgA, histatin-5, and lactoperoxidase levels in saliva of adolescents with dental caries.
24769851 2014 Tyrosine phosphorylation within the intrinsically disordered cytosolic domains of the B-cell receptor: an NMR-based structural analysis.
24146823 2013 Expression of the B-cell receptor component CD79a on immature myeloid cells contributes to their tumor promoting effects.
21324920 2011 Protein kinase C inhibitor sotrastaurin selectively inhibits the growth of CD79 mutant diffuse large B-cell lymphomas.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20102401 2010 BOB.1, CD79a and cyclin E are the most appropriate markers to discriminate classical Hodgkin's lymphoma from primary mediastinal large B-cell lymphoma.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...