Property Summary

Ligand Count 5
NCBI Gene PubMed Count 124
PubMed Score 79.51
PubTator Score 387.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Gingivitis 29 3.277 1.6
Lymphoma 81 3.079 1.5
Disease Target Count
Common variable immunodeficiency 5 1

Expression

  Differential Expression (22)

Disease log2 FC p
non-small cell lung carcinoma 1.800 7.5e-14
adult high grade glioma 1.500 1.0e-04
atypical teratoid / rhabdoid tumor 1.200 2.0e-03
Breast cancer -2.600 4.7e-02
Chronic Lymphocytic Leukemia -1.673 3.4e-04
chronic rhinosinusitis 1.452 5.0e-02
colon cancer -3.500 5.7e-03
cutaneous lupus erythematosus 4.400 7.1e-03
ductal carcinoma in situ 2.000 4.9e-02
glioblastoma 1.200 8.6e-03
interstitial cystitis 4.100 5.0e-03
invasive ductal carcinoma 1.500 3.1e-02
lung adenocarcinoma 1.100 3.5e-03
lung cancer -1.200 1.9e-03
lung carcinoma -1.100 1.5e-05
medulloblastoma, large-cell 1.400 1.0e-04
nasopharyngeal carcinoma -1.600 5.0e-03
non primary Sjogren syndrome sicca -1.100 2.7e-02
osteosarcoma -2.444 2.6e-03
ovarian cancer 1.200 1.6e-09
periodontitis 1.300 5.3e-14
ulcerative colitis 3.000 6.5e-03

Gene RIF (98)

AA Sequence

MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNGLFHIALGGLL      1 - 70
MIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILN     71 - 140
IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIFAFFQELVIAG    141 - 210
IVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFP    211 - 280
EPPQDQESSPIENDSSP                                                         281 - 297
//

Text Mined References (129)

PMID Year Title