Property Summary

NCBI Gene PubMed Count 115
Grant Count 5
Funding $200,030.74
PubMed Score 75.88
PubTator Score 387.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Chronic Lymphocytic Leukemia -1.673 0.000
cutaneous lupus erythematosus 4.400 0.007
osteosarcoma -6.332 0.000
periodontitis 1.300 0.000
atypical teratoid / rhabdoid tumor 1.200 0.002
glioblastoma 1.200 0.009
medulloblastoma, large-cell 1.600 0.000
colon cancer -3.500 0.006
lung cancer -1.400 0.000
Breast cancer -2.600 0.047
interstitial cystitis 4.500 0.008
lung adenocarcinoma 1.800 0.000
adult high grade glioma 1.600 0.001
primary Sjogren syndrome 6.100 0.000
nasopharyngeal carcinoma -2.800 0.012
lung carcinoma -1.100 0.000
non-small cell lung carcinoma 1.800 0.000
ductal carcinoma in situ 3.200 0.027
invasive ductal carcinoma 1.500 0.031
ulcerative colitis 4.000 0.002
ovarian cancer 1.400 0.000
chronic rhinosinusitis 1.452 0.050

Synonym

Accession P11836 A6NMS4 B4DT24 P08984 Q13963
Symbols B1
S7
Bp35
CD20
CVID5
MS4A2
LEU-16

Gene

PANTHER Protein Class (1)

PDB

3BKY   2OSL   1S8B   3PP4  

Gene RIF (89)

PMID Text
27090891 Data indicate that Philadelphia chromosome-positive (Ph-positive) acute lymphoblastic leukemia (ALL) patients who presented with cyclin dependent kinase inhibitor 2A/B (CDKN2A/B) deletion showed a higher rate of CD20 antigen expression.
26398317 the findings demonstrate that treatment with anti-CD20-hIFNalpha reverses resistance of B-NHL
26381030 Case Report: aberrant CD20 expression by skin-infiltrating T cells using multispectral imaging.
26299072 Characterize premature human NK/T-cell lymphoma cell line with expression of the B-cell marker CD20.
25517315 Data indicate that CD20 antigen downregulation relies on transcriptional mechanisms in SRC family kinases (SFKs)-dependent transcriptional regulation of CD20.
25449106 This study identified a novel D393-CD20-derived MHC Class II restricted epitopes that bind various HLA-DR alleles. IFN-gamma-producing D393-CD20 specific CD4 T cell responses were detected in blood lymphocytes from lymphoma patients and D393-CD20 specific CD4 Th1 clones were able to recognize both lymphoma cell lines and autologous lymphoma cells and to induce their apoptosis.
25394454 Letter/Review: Liver transplant recipients developing CD20-positive lymphoproliferative lesions are significantly older at time of transplantation.
25098425 Microenvironment CD20 + cells seem to play a favorable prognostic role in classical Hodgkin Lymphoma. Depletion of CD20 + cells together with an increase of TAMs identifies a group of patients with high-risk disease.
24928997 Data indicate that depletion of CD20-expressing T cells may also contribute to the therapeutic effect of rituximab (RTX).
24898664 In conclusion, SNPs of CD20 were not high risk factors of DLBCL, but the T allele of rs2070770 was a potential indicator of superior survival.
More...

AA Sequence

MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNGLFHIALGGLL      1 - 70
MIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILN     71 - 140
IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIFAFFQELVIAG    141 - 210
IVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFP    211 - 280
EPPQDQESSPIENDSSP                                                         281 - 297
//

Text Mined References (120)

PMID Year Title
27090891 2016 Correlation between deletion of the CDKN2 gene and tyrosine kinase inhibitor resistance in adult Philadelphia chromosome-positive acute lymphoblastic leukemia.
26398317 2015 Overcoming rituximab drug-resistance by the genetically engineered anti-CD20-hIFN-? fusion protein: Direct cytotoxicity and synergy with chemotherapy.
26381030 2015 Multispectral Imaging Approach to the Diagnosis of a CD20+ Cutaneous T-cell Lymphoproliferative Disorder: A Case Report.
26299072 2015 Establishment and Characterization of a CD20-Positive NK/T-Cell Lymphoma Cell Line.
25517315 2014 Inhibitors of SRC kinases impair antitumor activity of anti-CD20 monoclonal antibodies.
25449106 2015 CD20 alternative splicing isoform generates immunogenic CD4 helper T epitopes.
25416956 2014 A proteome-scale map of the human interactome network.
25394454 2014 Significance of CD20 expression by lymphoproliferative lesions developing after liver transplantation: post-transplant lymphoproliferative disorders international survey.
25098425 2015 High CD20+ background cells predict a favorable outcome in classical Hodgkin lymphoma and antagonize CD68+ macrophages.
24928997 2014 Rituximab efficiently depletes increased CD20-expressing T cells in multiple sclerosis patients.
More...