Property Summary

NCBI Gene PubMed Count 168
PubMed Score 721.81
PubTator Score 509.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Neoplasms 63 0.0 0.0
Disease Target Count P-value
Breast cancer 3577 1.3e-15
ovarian cancer 8519 5.9e-05
osteosarcoma 7950 1.1e-03
psoriasis 6694 3.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -1.100 1.3e-15
osteosarcoma -1.223 1.1e-03
ovarian cancer 1.400 5.9e-05
psoriasis -1.200 3.5e-03

Gene RIF (93)

AA Sequence

MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAP      1 - 70
TAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKT     71 - 140
RGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSET    141 - 210
GKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQ    211 - 280
TAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGA    281 - 350
VAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT    351 - 420
SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSN    421 - 490
LTELQVVNLDTAHSTKSE                                                        491 - 508
//

Text Mined References (174)

PMID Year Title