Property Summary

NCBI Gene PubMed Count 158
Grant Count 345
R01 Count 244
Funding $33,800,860.5
PubMed Score 688.51
PubTator Score 509.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.200 0.004
osteosarcoma -1.223 0.001
Breast cancer -1.100 0.000
ovarian cancer 1.400 0.000

Synonym

Accession P11831 Q5T648 SRF
Symbols MCM1

Gene

SRF

PDB

1HBX   1K6O   1SRS  

Gene RIF (83)

PMID Text
26801758 miR-483-3p is upregulated in Endothelial progenitor cells (EPCs) from deep vein thrombosis patients, and it targets SRF to decrease EPCs migration and tube formation.
26671411 The SRF-IL6 axis is the critical mediator of YAP-induced stemness in mammary epithelial cells and breast cancer.
26554816 FLNA functions as a positive cellular transducer linking actin polymerization to MKL1-SRF activity, counteracting the known repressive complex of MKL1 and monomeric G-actin.
26321231 ADGRG2 constitutively activates RhoA-SRE pathways.
26100622 STAT3 protein regulates vascular smooth muscle cell phenotypic switch by interaction with myocardin and SRF.
25896507 high levels of Myc engage Miz1 in repressive DNA binding complexes and suppress an SRF-dependent transcriptional program that supports survival of epithelial cells.
25728840 Data show that microRNA miR-320a is a key regulator of rtherogenesis, and down-regulating serum response factor (SRF).
25681733 These data support a central role of the SRF/MRTF pathway in the pathobiology of lung fibrosis.
25402621 SRF regulates neutrophil migration, integrin activation, and trafficking. Disruption of the SRF pathway results in myelodysplasia and immune dysfunction.
25080937 SRF promotes gastric cancer metastasis and the epithelial to mesenchymal transition through miR-199a-5p-mediated downregulation of E-cadherin.
More...

AA Sequence

MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAP      1 - 70
TAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKT     71 - 140
RGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSET    141 - 210
GKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQ    211 - 280
TAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGA    281 - 350
VAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT    351 - 420
SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSN    421 - 490
LTELQVVNLDTAHSTKSE                                                        491 - 508
//

Text Mined References (164)

PMID Year Title
26801758 2016 Upregulation of miR-483-3p contributes to endothelial progenitor cells dysfunction in deep vein thrombosis patients via SRF.
26671411 2015 A basal-like breast cancer-specific role for SRF-IL6 in YAP-induced cancer stemness.
26554816 2015 Filamin A interacts with the coactivator MKL1 to promote the activity of the transcription factor SRF and cell migration.
26321231 2015 The adhesion G protein-coupled receptor G2 (ADGRG2/GPR64) constitutively activates SRE and NF?B and is involved in cell adhesion and migration.
26100622 2015 STAT3 Protein Regulates Vascular Smooth Muscle Cell Phenotypic Switch by Interaction with Myocardin.
25896507 2015 Repression of SRF target genes is critical for Myc-dependent apoptosis of epithelial cells.
25728840 2015 MiR-320a contributes to atherogenesis by augmenting multiple risk factors and down-regulating SRF.
25681733 2015 Inhibition of myocardin-related transcription factor/serum response factor signaling decreases lung fibrosis and promotes mesenchymal cell apoptosis.
25402621 2015 The regulatory role of serum response factor pathway in neutrophil inflammatory response.
25298399 2014 Olfactomedin 2, a novel regulator for transforming growth factor-?-induced smooth muscle differentiation of human embryonic stem cell-derived mesenchymal cells.
More...