Property Summary

Ligand Count 487
NCBI Gene PubMed Count 360
PubMed Score 1546.30
PubTator Score 1069.62

Knowledge Summary

Patent (105,686)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Cancer 2499 6.693 3.3
Lipoma 32 4.65 2.3

Expression

  Differential Expression (18)

Disease log2 FC p
acute myeloid leukemia -1.200 4.2e-02
adult high grade glioma 3.000 2.9e-06
astrocytoma 1.500 9.5e-15
Astrocytoma, Pilocytic 1.300 3.5e-08
atypical teratoid / rhabdoid tumor 2.000 7.2e-11
colon cancer 1.100 4.9e-04
ependymoma 1.400 2.0e-13
glioblastoma 2.500 1.4e-09
group 3 medulloblastoma 1.900 1.4e-06
lung adenocarcinoma 1.300 4.3e-08
lung cancer 1.400 8.2e-03
malignant mesothelioma 1.100 2.2e-06
medulloblastoma, large-cell 2.100 1.4e-06
nasopharyngeal carcinoma 1.400 1.7e-05
non-small cell lung cancer 1.076 4.3e-22
oligodendroglioma 1.200 2.2e-02
ovarian cancer 1.900 3.2e-05
primitive neuroectodermal tumor 1.400 5.7e-05

Gene RIF (255)

AA Sequence

MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPN      1 - 70
VVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRD     71 - 140
LKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRR    141 - 210
KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNP    211 - 280
HKRISAFRALQHSYLHKDEGNPE                                                   281 - 303
//

Text Mined References (367)

PMID Year Title