Property Summary

NCBI Gene PubMed Count 328
Grant Count 874
R01 Count 524
Funding $79,820,393.95
PubMed Score 1381.18
PubTator Score 1069.62

Knowledge Summary

Patent (105,686)

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
oligodendroglioma 1.500 0.000
astrocytoma 1.500 0.000
glioblastoma 2.500 0.000
ependymoma 1.400 0.000
sonic hedgehog group medulloblastoma 2.300 0.000
atypical teratoid / rhabdoid tumor 2.000 0.000
medulloblastoma, large-cell 2.100 0.000
primitive neuroectodermal tumor 1.400 0.000
non-small cell lung cancer 1.076 0.000
lung cancer 1.800 0.000
colon cancer 1.100 0.000
adult high grade glioma 3.000 0.000
pilocytic astrocytoma 1.300 0.000
lung adenocarcinoma 1.300 0.000
nasopharyngeal carcinoma 1.400 0.000
acute myeloid leukemia -1.200 0.042
ovarian cancer 1.900 0.000

Synonym

Accession P11802 B2R9A0 B4DNF9 O00576 Q6FG61
Symbols CMM3
PSK-J3

Gene

PDB

2W96   2W99   2W9F   2W9Z   1LD2   3G33   5FWK   5FWL   5FWM  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (227)

PMID Text
26857361 This review highlights our current understanding of CDK signaling in both normal and malignant breast tissues, with special attention placed on recent clinical advances in inhibition of CDK4/6 in ER+ disease
26644182 PHD1 is phosphorylated by CDK2, CDK4 and CDK6 at Serine 130.
26559153 miR-539 plays an important role in the initiation and progression of nasopharyngeal carcinoma by targeting CDK4.
26497080 Results confirm that CEACAM6 promoted cell proliferation mediated by cyclin D1/CDK4.
26418250 Observations disclose the presence of CDK4 protein in human erythrocytes and its involvement in suicidal erythrocyte death.
26416047 showed that CCND1 and CDK4 mutations are associated with an increased risk of breast cancer
26369631 The concept that cotargeting MEK and CDK4/6 would prove efficacious in KRAS-mutant (KRAS(mt)) colorectal cancers.
26337082 Ewing sarcoma cells require CDK4 and cyclin D1 for survival and anchorage-independent growth.
26336885 amplification of HMGA2 was associated with the atypical lipomatous tumor/well-differentiated liposarcoma histological type and a good prognosis, whereas CDK4 and JUN amplifications were associated with dedifferentiated liposarcoma histology
26150472 CCND1-CDK4-mediated cell cycle progression provides a competitive advantage for human hematopoietic stem cells in vivo.
More...

AA Sequence

MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPN      1 - 70
VVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRD     71 - 140
LKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRR    141 - 210
KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNP    211 - 280
HKRISAFRALQHSYLHKDEGNPE                                                   281 - 303
//

Text Mined References (335)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26857361 2016 Targeting the cyclin-dependent kinases (CDK) 4/6 in estrogen receptor-positive breast cancers.
26644182 2016 CDK-dependent phosphorylation of PHD1 on serine 130 alters its substrate preference in cells.
26559153 2015 miR-539 induces cell cycle arrest in nasopharyngeal carcinoma by targeting cyclin-dependent kinase 4.
26497080 2016 Cell motility and spreading promoted by CEACAM6 through cyclin D1/CDK4 in human pancreatic carcinoma.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26418250 2015 Impact of cyclin-dependent kinase CDK4 inhibition on eryptosis.
26416047 Genetic polymorphisms in cell cycle regulatory genes CCND1 and CDK4 are associated with susceptibility to breast cancer.
26369631 2016 Sensitivity of KRAS-Mutant Colorectal Cancers to Combination Therapy That Cotargets MEK and CDK4/6.
More...