Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.24
PubTator Score 6.40

Knowledge Summary

Patent (959)

Expression

Gene RIF (2)

PMID Text
24447338 The amplified luminescent proximity homogeneous assay (AlphaScreen) identifies the interaction of HIV-1 Gag with PSKH1
14644153 A minimal region required for proper Golgi targeting of PSKH1 was identified within the first 29 amino acids; and structural and regulatory role of PSKH1 in maintenance of the Golgi apparatus is determined

AA Sequence

MGCGTSKVLPEPPKDVQLDLVKKVEPFSGTKSDVYKHFITEVDSVGPVKAGFPAASQYAHPCPGPPTAGH      1 - 70
TEPPSEPPRRARVAKYRAKFDPRVTAKYDIKALIGRGSFSRVVRVEHRATRQPYAIKMIETKYREGREVC     71 - 140
ESELRVLRRVRHANIIQLVEVFETQERVYMVMELATGGELFDRIIAKGSFTERDATRVLQMVLDGVRYLH    141 - 210
ALGITHRDLKPENLLYYHPGTDSKIIITDFGLASARKKGDDCLMKTTCGTPEYIAPEVLVRKPYTNSVDM    211 - 280
WALGVIAYILLSGTMPFEDDNRTRLYRQILRGKYSYSGEPWPSVSNLAKDFIDRLLTVDPGARMTALQAL    281 - 350
RHPWVVSMAASSSMKNLHRSISQNLLKRASSRCQSTKSAQSTRSSRSTRSNKSRRVRERELRELNLRYQQ    351 - 420
QYNG                                                                      421 - 424
//

Text Mined References (15)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14644153 2003 Mutants of the protein serine kinase PSKH1 disassemble the Golgi apparatus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466556 2002 PSKH1, a novel splice factor compartment-associated serine kinase.
More...