Property Summary

NCBI Gene PubMed Count 59
Grant Count 194
R01 Count 123
Funding $19,917,259.01
PubMed Score 216.12
PubTator Score 213.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P11766 Q6FHR2
Symbols FDH
ADHX
ADH-3
FALDH
GSNOR
GSH-FDH
HEL-S-60p

Gene

PANTHER Protein Class (2)

PDB

1M6H   1M6W   1MA0   1MC5   1MP0   1TEH   2FZE   2FZW   3QJ5  

Gene RIF (30)

PMID Text
26491229 GSNOR expression has different effect on neuronal viability in dependence on the stimulus applied, and plays opposite roles in SH-SY5Y models of Parkinson's disease and amyotrophic lateral sclerosis
24895131 ADH5 counteracts neuronal differentiation of neural stem cells and this effect can be reversed by pharmacological inhibition of ADH5.
23468174 common ADH variants conferred risk for both schizophrenia in African-Americans and autism in European-Americans.
23355119 study compared individuals occupationally exposed to formaldehyde and controls to effects of XRCC3 Thr241Met, ADH5 Val309Ile and Asp353Glu polymorphisms; ADH5 polymorphisms did not show significant association with genotoxicity biomarkers
23285246 A decrease in ADH IB, rather than GSNOR, correlates with human lung cancer.
22335564 N6022 binds in the GSNO binding pocket like a competitive inhibitor, although in kinetic assays it behaves with a mixed uncompetitive mode of inhibition (MOI) toward GSNO and a mixed competitive MOI toward formaldehyde adduct S-hydroxymethylglutathione.
21920416 biological significance of SNPs rs11568816, rs17028487 and rs13832
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGA      1 - 70
GIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHY     71 - 140
MGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMG    141 - 210
CKVAGASRIIGVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALE    211 - 280
ACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNL    281 - 350
SFDEINKAFELMHSGKSIRTVVKI                                                  351 - 374
//

Text Mined References (63)

PMID Year Title
26491229 2015 S-Nitrosoglutathione Reductase Plays Opposite Roles in SH-SY5Y Models of Parkinson's Disease and Amyotrophic Lateral Sclerosis.
24895131 2014 A novel suppressive effect of alcohol dehydrogenase 5 in neuronal differentiation.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23468174 2013 Association between common alcohol dehydrogenase gene (ADH) variants and schizophrenia and autism.
23456092 2013 Extended genetic effects of ADH cluster genes on the risk of alcohol dependence: from GWAS to replication.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23355119 2013 The influence of genetic polymorphisms in XRCC3 and ADH5 genes on the frequency of genotoxicity biomarkers in workers exposed to formaldehyde.
More...