Property Summary

Ligand Count 31
NCBI Gene PubMed Count 60
PubMed Score 239.49
PubTator Score 213.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

 IMPC Phenotype (1)

Gene RIF (31)

AA Sequence

MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGA      1 - 70
GIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHY     71 - 140
MGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMG    141 - 210
CKVAGASRIIGVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALE    211 - 280
ACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNL    281 - 350
SFDEINKAFELMHSGKSIRTVVKI                                                  351 - 374
//

Text Mined References (64)

PMID Year Title