Property Summary

NCBI Gene PubMed Count 171
Grant Count 104
R01 Count 60
Funding $7,210,528.87
PubMed Score 525.61
PubTator Score 329.71

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P11717 Q7Z7G9 Q96PT5 CI Man-6-P receptor
Symbols MPR1
MPRI
CD222
CIMPR
M6P-R
MPR300
CI-M6PR
MPR 300
M6P/IGF2R

Gene

PANTHER Protein Class (1)

PDB

1JWG   1JPL   1LF8   2L29   2V5P   1E6F   1GP0   1GP3   1GQB   2CNJ   2L2A   2M68   2M6T   2V5N   2V5O   5IEI  

Gene RIF (128)

PMID Text
26683100 Data show one single nucleotide polymorphism (SNP) in Fox transcription factor FOXO3 (FOXO3) was significantly associated with longevity, and the six SNPs in proto-oncogene protein AKT1 (AKT1) gene and in IGF-2 Receptor (IGF-2R) gene are not.
26610485 CREB plays an important role in the inhibition of IGF2R expression by binding to the IGF2R promoter and further suppresses H9c2 cardiomyoblast cell apoptosis induced by IGF2R signaling under hypoxic conditions.
25939386 Results show that insulin-like growth factor II (IGF-II) overexpression enhanced the levels of amyloid precursor protein (APP) in SK-N-AS neuroblastoma cells.
25922844 IGF2R gene polymorphism and circulating IGF2R are associated with T2DM
25890304 This study showed that Plasma IGF2R levels were positively correlated with plasma HIV viral load.
25402559 IGF2R silencing significantly enhanced the chemo-resistance of NSCLC cell lines to cisplatin treatment.
25278553 Report genes involved in trafficking of the mannose 6-phosphate receptors between the trans-Golgi network, endosomes and the plasma membrane.
25127865 CD222 specifically controls the balance between active and inactive Lck in resting T cells, which guarantees operative T cell effector functions.
24956249 there is no evidence that IGF2 methylation was influenced by SNPs within the IGF1, IGF1R or IGF2R genes, which lie on other chromosomes.
24656929 IGF-2, IGF-2R, and IRS-2 genes polymorphisms and their combinations are associated with risk of HCC
More...

AA Sequence

MGAAAGRSPHLGPAPARRPQRSLLLLQLLLLVAAPGSTQAQAAPFPELCSYTWEAVDTKNNVLYKINICG      1 - 70
SVDIVQCGPSSAVCMHDLKTRTYHSVGDSVLRSATRSLLEFNTTVSCDQQGTNHRVQSSIAFLCGKTLGT     71 - 140
PEFVTATECVHYFEWRTTAACKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFIN    141 - 210
VCRDIDTLRDPGSQLRACPPGTAACLVRGHQAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSP    211 - 280
AVTITFVCPSERREGTIPKLTAKSNCRYEIEWITEYACHRDYLESKTCSLSGEQQDVSIDLTPLAQSGGS    281 - 350
SYISDGKEYLFYLNVCGETEIQFCNKKQAAVCQVKKSDTSQVKAAGRYHNQTLRYSDGDLTLIYFGGDEC    351 - 420
SSGFQRMSVINFECNKTAGNDGKGTPVFTGEVDCTYFFTWDTEYACVKEKEDLLCGATDGKKRYDLSALV    421 - 490
RHAEPEQNWEAVDGSQTETEKKHFFINICHRVLQEGKARGCPEDAAVCAVDKNGSKNLGKFISSPMKEKG    491 - 560
NIQLSYSDGDDCGHGKKIKTNITLVCKPGDLESAPVLRTSGEGGCFYEFEWHTAAACVLSKTEGENCTVF    561 - 630
DSQAGFSFDLSPLTKKNGAYKVETKKYDFYINVCGPVSVSPCQPDSGACQVAKSDEKTWNLGLSNAKLSY    631 - 700
YDGMIQLNYRGGTPYNNERHTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECVVT    701 - 770
DPSTLEQYDLSSLAKSEGGLGGNWYAMDNSGEHVTWRKYYINVCRPLNPVPGCNRYASACQMKYEKDQGS    771 - 840
FTEVVSISNLGMAKTGPVVEDSGSLLLEYVNGSACTTSDGRQTTYTTRIHLVCSRGRLNSHPIFSLNWEC    841 - 910
VVSFLWNTEAACPIQTTTDTDQACSIRDPNSGFVFNLNPLNSSQGYNVSGIGKIFMFNVCGTMPVCGTIL    911 - 980
GKPASGCEAETQTEELKNWKPARPVGIEKSLQLSTEGFITLTYKGPLSAKGTADAFIVRFVCNDDVYSGP    981 - 1050
LKFLHQDIDSGQGIRNTYFEFETALACVPSPVDCQVTDLAGNEYDLTGLSTVRKPWTAVDTSVDGRKRTF   1051 - 1120
YLSVCNPLPYIPGCQGSAVGSCLVSEGNSWNLGVVQMSPQAAANGSLSIMYVNGDKCGNQRFSTRITFEC   1121 - 1190
AQISGSPAFQLQDGCEYVFIWRTVEACPVVRVEGDNCEVKDPRHGNLYDLKPLGLNDTIVSAGEYTYYFR   1191 - 1260
VCGKLSSDVCPTSDKSKVVSSCQEKREPQGFHKVAGLLTQKLTYENGLLKMNFTGGDTCHKVYQRSTAIF   1261 - 1330
FYCDRGTQRPVFLKETSDCSYLFEWRTQYACPPFDLTECSFKDGAGNSFDLSSLSRYSDNWEAITGTGDP   1331 - 1400
EHYLINVCKSLAPQAGTEPCPPEAAACLLGGSKPVNLGRVRDGPQWRDGIIVLKYVDGDLCPDGIRKKST   1401 - 1470
TIRFTCSESQVNSRPMFISAVEDCEYTFAWPTATACPMKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTA   1471 - 1540
AYSEKGLVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVI   1541 - 1610
SFVCRPEARPTNRPMLISLDKQTCTLFFSWHTPLACEQATECSVRNGSSIVDLSPLIHRTGGYEAYDESE   1611 - 1680
DDASDTNPDFYINICQPLNPMHGVPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPIANEIYLNFESSTPC   1681 - 1750
LADKHFNYTSLIAFHCKRGVSMGTPKLLRTSECDFVFEWETPVVCPDEVRMDGCTLTDEQLLYSFNLSSL   1751 - 1820
STSTFKVTRDSRTYSVGVCTFAVGPEQGGCKDGGVCLLSGTKGASFGRLQSMKLDYRHQDEAVVLSYVNG   1821 - 1890
DRCPPETDDGVPCVFPFIFNGKSYEECIIESRAKLWCSTTADYDRDHEWGFCRHSNSYRTSSIIFKCDED   1891 - 1960
EDIGRPQVFSEVRGCDVTFEWKTKVVCPPKKLECKFVQKHKTYDLRLLSSLTGSWSLVHNGVSYYINLCQ   1961 - 2030
KIYKGPLGCSERASICRRTTTGDVQVLGLVHTQKLGVIGDKVVVTYSKGYPCGGNKTASSVIELTCTKTV   2031 - 2100
GRPAFKRFDIDSCTYYFSWDSRAACAVKPQEVQMVNGTITNPINGKSFSLGDIYFKLFRASGDMRTNGDN   2101 - 2170
YLYEIQLSSITSSRNPACSGANICQVKPNDQHFSRKVGTSDKTKYYLQDGDLDVVFASSSKCGKDKTKSV   2171 - 2240
SSTIFFHCDPLVEDGIPEFSHETADCQYLFSWYTSAVCPLGVGFDSENPGDDGQMHKGLSERSQAVGAVL   2241 - 2310
SLLLVALTCCLLALLLYKKERRETVISKLTTCCRRSSNVSYKYSKVNKEEETDENETEWLMEEIQLPPPR   2311 - 2380
QGKEGQENGHITTKSVKALSSLHGDDQDSEDEVLTIPEVKVHSGRGAGAESSHPVRNAQSNALQEREDDR   2381 - 2450
VGLVRGEKARKGKSSSAQQKTVSSTKLVSFHDDSDEDLLHI                                2451 - 2491
//

Text Mined References (188)

PMID Year Title
26683100 2016 Association study of polymorphisms in FOXO3, AKT1 and IGF-2R genes with human longevity in a Han Chinese population.
26610485 2015 CREB Negatively Regulates IGF2R Gene Expression and Downstream Pathways to Inhibit Hypoxia-Induced H9c2 Cardiomyoblast Cell Death.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25939386 2015 Overexpression of the Insulin-Like Growth Factor II Receptor Increases ?-Amyloid Production and Affects Cell Viability.
25922844 2015 The association of soluble IGF2R and IGF2R gene polymorphism with type 2 diabetes.
25890304 2015 Insulin-like growth factors and related proteins in plasma and cerebrospinal fluids of HIV-positive individuals.
25402559 2014 IGF2R expression is associated with the chemotherapy response and prognosis of patients with advanced NSCLC.
25278553 2014 A high-throughput siRNA screen identifies genes that regulate mannose 6-phosphate receptor trafficking.
25127865 2014 The late endosomal transporter CD222 directs the spatial distribution and activity of Lck.
24956249 2014 No association between genetic or epigenetic variation in insulin growth factors and antipsychotic-induced metabolic disturbances in a cross-sectional sample.
More...