Property Summary

NCBI Gene PubMed Count 797
Grant Count 243
R01 Count 103
Funding $35,444,100.19
PubMed Score 1560.25
PubTator Score 1943.45

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P11712 P11713 Q16756 Q16872 Q5VX92 Q6IRV8 Q8WW80
Symbols CPC9
CYP2C
CYP2C10
CYPIIC9
P450IIC9

Gene

PDB

1OG2   1OG5   1R9O   4NZ2   5A5I  

 OMIM Term (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
777 screening 18731 / 0 / 77137 CYP2C9 Assay
883 confirmatory 1327 / 1406 / 7587 qHTS Assay for Inhibitors and Substrates of Cytochrome P450 2C9
1024 screening 1368 / 0 / 94500 HTS Assay for Activators of Cytochrome P450 2A9
1851 other 0 / 0 / 0 Cytochrome panel assay with activity outcomes

Gene RIF (858)

PMID Text
26894931 Patients with variant CYP2C9 are at increased risk for cyclophosphamide-induced leukopenia but may have a better chance to respond to treatment.
26757860 There was no association between CYP2C9*2 and*3 and acenocoumarol or warfarin requirements.
26690534 In the title.
26669712 P450 (Cytochrome) Oxidoreductase Gene (POR) Common Variant (POR*28) Significantly Alters CYP2C9 Activity in Swedish, But Not in Korean Healthy Subjects
26554252 Patients with the mutant genotype showed a higher TC-lowering and LDL-lowing effect compared to those with wild-type genotypes. The CYP2C9 polymorphism may be involved in the lipid-lowering efficacy of rosuvastatin in patients with hyperlipidemia.
26469104 The presence of CYP2C9*2 and/or *3 genotypes is associated with unstable warfarin treatment in patients after heart valve replacement, regardless of the type of INR testing.
26422867 CYP2C9 genotypic data-based dose prediction alone does not accurately predict warfarin dose requirements in some Malaysian patients.
26255664 The novel mutation can greatly decrease the enzymatic activity of the CYP2C9 enzyme both in vitro and in vivo
26122864 CYP2C9*2 carriers had a lower S-ibuprofen clearance and a higher S-ibuprofen AUC and half-life
26050796 Our algorithm achieved a determination coefficient of 40% including the variables age, gender, weight, height, self-declared race, amiodarone use, enzyme inducers use, VKORC1 genotypes and predicted phenotypes according to CYP2C9 polymorphisms
More...

AA Sequence

MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFG      1 - 70
LKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRS     71 - 140
IEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFHKRFDYKDQQFLNLMEKLNENIKILSS    141 - 210
PWIQICNNFSPIIDYFPGTHNKLLKNVAFMKSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPS    211 - 280
EFTIESLENTAVDLFGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDA    281 - 350
VVHEVQRYIDLLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFK    351 - 420
KSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV    421 - 490
//

Text Mined References (804)

PMID Year Title
26894931 2016 Cyclophosphamide treatment-induced leukopenia rates in ANCA-associated vasculitis are influenced by variant CYP450 2C9 genotypes.
26757860 2015 [Effect of VKORC1 and CYP2C9 variants on dosage of oral anticoagulants in Chilean individuals].
26690534 2015 Characterization of drug-metabolizing enzymes CYP2C9, CYP2C19 polymorphisms in Tunisian, Kuwaiti and Bahraini populations.
26669712 2015 P450 (Cytochrome) Oxidoreductase Gene (POR) Common Variant (POR*28) Significantly Alters CYP2C9 Activity in Swedish, But Not in Korean Healthy Subjects.
26554252 2015 CYP2C9 Genetic Polymorphism is a Potential Predictive Marker for the Efficacy of Rosuvastatin Therapy.
26469104 CYP2C9 Polymorphism and Unstable Anticoagulation with Warfarin in Patients Within the First 3 Months Following Heart Valve Replacement.
26422867 2015 VKORC1 and CYP2C9 genotypic data-based dose prediction alone does not accurately predict warfarin dose requirements in some Malaysian patients.
26255664 2015 Identification and characterization of a novel CYP2C9 allelic variant in a warfarin-sensitive patient.
26122864 2015 Effect of gender and CYP2C9 and CYP2C8 polymorphisms on the pharmacokinetics of ibuprofen enantiomers.
26050796 2015 Development of a pharmacogenetic-based warfarin dosing algorithm and its performance in Brazilian patients: highlighting the importance of population-specific calibration.
More...