Property Summary

NCBI Gene PubMed Count 797
PubMed Score 1560.25
PubTator Score 1943.45

Knowledge Summary

Patent

No data available

Expression

 OMIM Phenotype (1)

Protein-protein Interaction (5)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
777 screening 18731 / 0 / 77137 CYP2C9 Assay
883 confirmatory 1327 / 1406 / 7587 qHTS Assay for Inhibitors and Substrates of Cytochrome P450 2C9
1024 screening 1368 / 0 / 94500 HTS Assay for Activators of Cytochrome P450 2A9
1851 other 0 / 0 / 0 Cytochrome panel assay with activity outcomes

Gene RIF (858)

PMID Text
26894931 Patients with variant CYP2C9 are at increased risk for cyclophosphamide-induced leukopenia but may have a better chance to respond to treatment.
26757860 There was no association between CYP2C9*2 and*3 and acenocoumarol or warfarin requirements.
26690534 In the title.
26669712 P450 (Cytochrome) Oxidoreductase Gene (POR) Common Variant (POR*28) Significantly Alters CYP2C9 Activity in Swedish, But Not in Korean Healthy Subjects
26554252 Patients with the mutant genotype showed a higher TC-lowering and LDL-lowing effect compared to those with wild-type genotypes. The CYP2C9 polymorphism may be involved in the lipid-lowering efficacy of rosuvastatin in patients with hyperlipidemia.
26469104 The presence of CYP2C9*2 and/or *3 genotypes is associated with unstable warfarin treatment in patients after heart valve replacement, regardless of the type of INR testing.
26422867 CYP2C9 genotypic data-based dose prediction alone does not accurately predict warfarin dose requirements in some Malaysian patients.
26255664 The novel mutation can greatly decrease the enzymatic activity of the CYP2C9 enzyme both in vitro and in vivo
26122864 CYP2C9*2 carriers had a lower S-ibuprofen clearance and a higher S-ibuprofen AUC and half-life
26050796 Our algorithm achieved a determination coefficient of 40% including the variables age, gender, weight, height, self-declared race, amiodarone use, enzyme inducers use, VKORC1 genotypes and predicted phenotypes according to CYP2C9 polymorphisms
26024874 Polymorphisms in CYP2C9 gene is associated with warfarin dose changes in different race during venous thromboembolism.
26010205 Rate of fall in INR on warfarin withdrawal is dependent on CYP2C9 genotype.
25994870 The CYP2C9*3 is a reasonable predictive genetic marker to anticipate SCARs (severe cutaneous adverse reactions) from phenytoin.
25994031 mutation can greatly decrease the enzymatic activity of the CYP2C9 protein both in vitro and in vivo
25967074 This study showed that CYP2C9-status can contribute to the optimization of VPA dosing and to the avoidance of misdosing-induced side effects.
25958051 Allele frequency of CYP2C9 polymorphisms in Tibetan individuals.
25951663 this study demonstrated that more attention should be given to subjects carrying these CYP2C9 alleles when administering diclofena
25943175 CYP2C9 genotype based phenytoin therapy is highly relevant in Kashmiri population due to a high incidence of genetic variations associated with therapeutic and adverse responses to phenytoin.
25924705 Effect of CYP2C9 Genetic Polymorphism in a Chinese Population on the Metabolism of Mestranol in vitro
25904339 study suggest that polymorphic variants of CYP2C9 (*2 and *3) might influence warfarin dose requirements and associated with the low dose of warfarin in patients.
25832633 Impact of CYP2C9 polymorphism found in the Chinese population on the metabolism of propofol in vitro
25823787 CYP2C9*2 and CYP2C9*3 variants result in disruption of hydrogen bonding interactions with warfarin and longer distance between C7 and Fe-O thus impairing warfarin 7-hydroxylation due to lower binding affinity of warfarin
25803758 This study demonstrated that Clinical evaluation of analgesic ineffectiveness and adverse effects led to the high likelihood of identifying patients with CYP2D6, CYP2C19, and CYP2C9 alleles associated with alterations in analgesic metabolism.
25802328 Data suggest that MIR130B (microRNA 130b) down-regulates CYP2C9 expression in hepatocytes; thus, MIR130B may be involved in regulation of drug metabolism and cholestasis/inflammation (in which MIR130B expression is up-regulated).
25795462 Data suggest that short-term fasting up-regulates hepatic expression of CYP1A2 but down-regulates hepatic expression of CYP2C9 as compared with the post-absorptive state; only male subjects were studied.
25712887 These results indicate that the individuals carrying of CYP2C9*3 have significant reduction in flurbiprofen metabolism
25712185 CYP2C9*8 and body surface area or body weight were predictors of plasma S-warfarin concentration in African-Americans.
25704921 the expression of hsa-miR-128-3p is inversely correlated with the expression of CYP2C9 in hepatocellular carcinoma tumor tissues; the study helped to elucidate the mechanism of CYP2C9 regulation by hsa-miR-128-3p, and the inverse association in hepatocellular carcinoma
25699611 Genetic polymorphisms in VKORC1, CYP2C9 along with age and height are determinants of warfarin dose requirements in Egyptian population acute coronary syndrome.
25644970 The CYP3A4*22 allele is significant associated with the development of cancer post-kidney transplantation. It is not significantly associated with graft survival.
25591012 Drug modulation of water-heme interactions in low-spin P450 complexes of CYP2C9d and CYP125A1.
25560582 We did not observe any association of CYP2C8*2, CYP2C8*3, CYP2C9*2 and CYP2C9*3 with myocardial infarction
25560189 For Mestizo populations, the proportion of CYP2C9 extensive (79%), intermediate (20.0%) and poor metabolizers (1.0%) was significantly different from that of natives, and varied among the different states of Mexico.
25552922 Allele frequency of CYP2C9 polymorphisms in the Japanese population
25521356 The CYP2C9*3 allele may double the risk of major bleeding among patients taking warfarin for 30 or more days
25518510 Evaluation of ADP-induced platelet aggregation in patients with different CYP2C9 gene polymorphisms during the administration of original or generic clopidogrel showed no significant differences in its resistance.
25499099 findings indicate that rs7089580 is associated with higher S-warfarin clearance and CYP2C9 expression and may help explain the higher dose requirement of warfarin in African Americans
25492821 VKORC1 and CYP2C9 are two genes responsible for warfarin metabolism
25461246 The International Warfarin Pharmacogenetics Consortium algorithm underdosed warfarin by 0.8 mg/day for patients with the rs12777823 GG genotype and overdosed warfarin by 0.7 mg/day in carriers of a variant CYP2C9 allele.
25406731 The present study shows that elevated EET levels in BC tissues are associated with upregulation of CYP2C8, 2C9, and 2J2, and downregulation of sEH, and are also associated with aggressive cell behavior in BC patients.
25391650 MED25 is important for regulating the epigenetic landscape resulting in transcriptional activation of a highly inducible gene, CYP2C9
25356900 Around 42.5% of the overall interindividual variability in warfarin dose requirements was explained : VKORC1 genotype accounted for 29.6%, CYP2C9 genotype for 4.3%, age for 3.6%, the CYP4F2 genotype for 3.3%, and CAR/HNF4alpha (rs2501873/rs3212198) for 1.7%
25332267 Variant alleles of CYP2C9 were more common in patients with bosentan-induced liver injury.
25318916 Due to the combination of frequent alleles CYP2C9*2, CYP2C9*3 and VKORC1*2 in Slovak population we determine that 25% of population need a standard 5-mg daily dose of warfarin, while 44%, 23%, and 8% need 4 mg, 3 mg and 2 mg of warfarin per day
25304014 Results signified the combined effects of VKORC1 1173 C>T and CYP2C9*3 polymorphisms with clinical factors such as age, weight of patients on the treatment of a risk of bleeding due to overdosing and thromboembolic events due to underdosing.
25303293 The CYP2C9 IVS8-109T allele was associated with an increased CYP2C9 hydroxylation capacity.
25241292 CYP2C9 polymorphisms determine the metabolic profile and biotransformation of metamizole.
25182955 CYP2C9 may be a risk genetic marker of coronary artery disease in women.
25155935 VKORC1 variant (-1639A) was shown to be prevalent amongst Tibeto-Burmans, whereas CYP2C9 (R144C, I359L) and CYP4F2 (V433M) variants were observed in considerable variability amongst Indo-Europeans
25142093 in carriers of CYP2C9 gene variations, the interference with the VKA metabolism is modified by PPI co-medication and the VCKORC1 genotype.
25121365 No association of 416 C > T and 1061 A > T in CYP2C9 or 681 G > A and 636 G > A in CYP2C19 was observed with response phenotype in genotypic analysis.
25099164 summarize evidence from the published literature supporting these associations and provide recommendations for the use of phenytoin based on CYP2C9 and/or HLA-B genotype
25096692 study identified CYP2C variants, including CYP2C9*3, known to reduce drug clearance, as important genetic factors associated with phenytoin-related severe cutaneous adverse reactions
25041257 The use of meloxicam and CYP2C9*3SNPs were significantly associated with an increased risk for diaphragm disease.
24986093 Report possible drug-drug interaction of losartan and glimepiride metabolism by recombinant microsome CYP2C9*1, 2C9*3, 2C9*13, and 2C9*16.
24978953 VKORC1S1639 GG and the wild type CYP2C9*1*1 genotypes are associated with the high-dose requirement for warfarin therapy.
24974237 This study suggest the dominant effect of CYP2C9 gene polymorphisms on early achievement of target International Normalized Ratio and supratherapeutic International Normalized Ratio > 3.1 values.
24966969 Report high resolution melting method to detect single nucleotide polymorphism of CYP2C9 in patients of Han ethnic group.
24962733 Polymorphisms in CYP2C9 gene (related to the metabolism of the potent S-enantiomer of warfarin) is considered to be responsible for the variability in the individual daily dose requirement in Thromboembolic diseases treatment.
24960263 Med25 is identified as a new coactivator of ERalpha that is required for ERalpha-mediated regulation of CYP2C9 expression
24956252 In addition to VKORC1 and CYP2C9, CYP4F2 gene has a slight but significant role in reaching INR >2.5 during the first weeks of acenocoumarol therapy.
24919870 genetic polymorphism is associated with acenocoumarol treatment safety in patients with atrial fibrillation or venous thromboembolism
24917142 he CYP-derived 11,12-EET may exhibit a proangiogenic biological function in the retina following stimulation by hypoxia in astrocytes. Inhibition of CYP may provide a rational therapy against retinal NV, because it can reduce VEGF production
24911077 distribution of INR was influenced by variants in CYP4F2 rs2108622, CYP2C9*3, rs9332230, VKORC1 1173C>T, -1639G>A, rs55894764, ABCB1 rs2032582, rs1128503, rs1045642 and F5 rs6025, age, smoking and concomitant drugs
24889181 The frequencies of CYP2C9 alleles in an African American pediatric sickle cell disease cohort, were determined.
24858991 The frequency of CYP2C9, CYP4F2, and VKORC1 polymorphisms in Russian patients with thrombosis is comparable with other European ethnic groups.
24830941 To bring the distal and proximal AP-1 sites together to activate the CYP2C9 promoter.
24798722 The investigators conducted a retrospective analysis of 1143 individuals with known CYP2D6, CYP2C19 and CYP2C9 genotypes for drug interactions
24797541 allele frequency of the studied genes was CYP2C9*2 (0.085), CYP2C9*3 (0.12), VKORC1 1173T (0.52), and VKORC1 -1639A (0.54)
24615047 CYP2C9*3 was found to play an important role in the metabolism of meloxicam by reducing its enzymatic activity.
24602049 This study aimed to evaluate the effect of gene polymorphisms of CYP2C9, VKORC1, thrombomodulin (THBD) and C-reactive protein (CRP) on the risk of bleeding complications of warfarin at therapeutic INR in Korean patients with mechanical cardiac valves
24601977 our results confirm the importance of age and VKORC1/CYP2C9 variants to stable warfarin dose in children.
24593903 Data show that the allele frequencies of cytochrome P450 enzymes CYP2C9*2, CYP2C9*3 and CYP3A5*3 were found to be 0.162, 0.112 and 0.943 respectively, whereas vitamin K epoxide reductase complex subunit 1 (VKORC1 )- 1639A was 0.534.
24530212 Study emphasizes the fact that polymorphisms in CYP2C9 gene and co-medication with phenytoin alter the anticoagulant effect of acenocoumarol.
24527758 believe that the findings are the first results of CYP allele distributions in the Turkish population and provide an understanding of the epidemiological studies that correlate therapeutic approaches and etiology of CRC especially in Turkish patients
24492587 Amino acid residue 72 plays a key role in tricyclic antidepressant drug metabolism by limiting the binding affinities of CYP2C19 and CYP2C9.
24474498 CYP2C9 *2 and*3 genotypes accounted for 1 and 7.9% of warfarin dose variability, respectively. CYP2C9*3 carriers had an increased risk of major bleeding. An additional variant in CYP2C9 (rs7089580) was significantly associated with warfarin dose.
24464600 POR*28 allele is an important source of CYP2C9 activity variability and combined with CYP2C9 gene poly-morphisms may explain individual variability in the effect of sulfonylureas.
24442125 All patients were genotyped for CYP2C9, KCNJ11 and ABCC8.
24430292 These data are compatible with a higher CYP2C8, CYP2C9, and CYP2C19 activity in Mestizo Ecuadorians as opposed to Spaniards, which could imply differences in dosage requirements for drugs metabolized by these cytochromes
24414392 there is evidence to indicate a significant association between CYP2C9 430C>T polymorphism and colorectal cancer/colorectal adenomas risk
24403552 CYP2C19 and 2C9 genotypes were not major determinants of voriconazole metabolism. No toxic serum level of voriconazole or its metabolites could be identified.
24399734 Report effect of CYP2C9 genotype on warfarin dosing in Indian patients.
24340040 the number of drugs that are metabolized by each CYP, the impact of CYP SNPs, as well as CYP expression patterns in different tissues. The most important polymorphic CYPs were found to be 1A2, 2D6, 2C9 and 2C19.
24338437 Results confirm the importance of the CYP2C9*3 variant in conferring a multiple drug-resistant phenotype against antiepileptic drugs.
24337438 genetic polymorphism does not influence fluindione dose requirement in elderly inpatients in a predictive model
24322170 results indicate that CYP2C9*3/*3 individuals may be at a higher risk for concentration-dependent adverse effects during long-term treatment with standard doses of meloxicam
24288737 Significant correlations with chemotherapy resistance were observed for CYP2C8*3 and CYP2C9*2 polymorphisms in patients with chronic lymphoproliferative diseases.
24222221 In a Mexican population CYP2C19 is more involved in acenocoumarol metabolism than CYP2C9 and APOE.
24166101 Our results show that the immobilization of CYP2C9 enzymes to a PMMA surface represents a viable and alternative approach to the preparation of CYP2C9 metabolites for toxicity testing
24038489 The current study suggests no statistically significant differences in the in vivo activity of CYP2C9 and CYP3A4 in patients with either glomerulonephritis or nonglomerular chronic kidney diseases
24029542 CYP2C9 (p=0.004) and VKORC1 (p=0.02) variant carriers required lower cumulative doses, and CYP4F2 carriers required higher doses (p=0.04) of warfarin to reach an INR of 2.0
24024895 Our preliminary data demonstrate an association between fluvastatin-induced ADRs in RTRs and genetic variants in the CYP2C9 and ABCG2 genes.
23959274 findings show for the first time interethnic differences between Hispanic groups in urinary diclofenac/4'-OH diclofenac ratios, and the relevance of CYP2C9*3 and CYP2C9*8 alleles
23941071 These findings indicate that individuals carrying the CYP2C19 rs3814637CC or CYP2C9 rs1057910AA or GGCX rs699664AA genotype needed higher warfarin doses in the Chinese population.
23932037 In this review, CYP2C9*3 is the main genetic risk factor for warfarin hemorrhagic complications.
23930675 Polymorphisms in CYP2C9, CYP2C19 and SLC10A1 had minimal lipid-lowering effects.
23863877 CYP2C9*2 is a potential genetic marker for prediction of bosentan-induced liver injury
23849849 CYP 2C9 polymorphism is associated with higher BMD, independent of plasma levels of phenytoin.
23844998 Of 36 allelic variants in a Han Chinese population, one exhibited markedly increased values in losartan clearance (>250%), whereas 33 variants exhibited significantly decreased values (from 20 to 96%) due to increased Km and/or decreased Vmax values.
23834474 Report expanded pharmacokinetic model that can be used to evaluate different dosing scenarios, during pregnancy, of drugs cleared by CYP2C9.
23800980 VKORC1-1639G>A and CYP2C9 polymorphisms contribute to the difference in warfarin dose requirements and quality of anticoagulation amongst Egyptian patients.
23775837 Isoniazid was found to form covalent adducts with CYP2E1, CYP3A4, and CYP2C9 with autoantibodies.
23774101 Variant alleles carry elevated risk of major bleeding events during warfarin treatment.
23755828 A novel CYP2C single nucleotide polymorphism exerts a clinically relevant effect on warfarin dose in African Americans, independent of CYP2C9*2 and CYP2C9*3
23752738 In vitro analysis of CYP2C9 variant proteins should be useful for predicting CYP2C9 phenotypes and for application to personalized drug therapy.
23732294 The CYP2C9*2/CYP2C9*3 variants were significantly associated with femoral BMD in a selected elderly Austrian population.
23726967 The study identifies common polymorphisms limked to warfarin resistance and sensitivity in the VKORC1, CYP2C9 and CYP4F2 genes.
23688605 The patients with the rare CYP2C9*12 rs9332239 genotype must have lower warfarin dose requirements.
23677510 The effect of CYP2C9, VKORC1 and CYP4F2 polymorphism and of clinical factors on warfarin dosage during initiation and long-term treatment after heart valve surgery.
23651023 The presence of CYP2C9 polymorphisms almost tripled the risk of overanticoagulation.
23615745 CYP2B6 and CYP2C9 polymorphisms seem to be associated with prasugrel low-response.
23586031 The low frequency of the CYP2C9 *3 allele combined with the absence of subjects carrying 2 defective CYP2C9 alleles suggests that, in this specific population, pharmacogenetic COAs dosing may mostly rely upon VKORC1 genotyping.
23582453 A 3D structure model of the mutant protein revealed that the substituted His204 led to restricted binding of the coumarin drug within the binding site of CYP2C9, thereby inhibiting its metabolic clearance and increasing its pharmacologic effect.
23577132 the *2, *3 polymorphisms of CYP2C9 gene are not associated with CRC susceptibility
23563037 Genotype frequency of CYP2C9 and VKORC1 SNPs is variable among the two ethno-geographically distinct Indian populations; this could translate into diverse warfarin response and risk of bleeding episodes
23556337 Compared to CYP2C9*1/*1 carriers, CYP2C9*1/*3 carriers had higher AUC and peak plasma concentration of pitavastatin acid and AUC of pitavastatin lactone
23481074 The study findings point towards the role of CYP2C9 and VKORC1 gene polymorphisms in determining the inter-individual dose variability of acenocoumarol in the Indian patients with mechanical heart valve replacement.
23473641 The genetic polymorphisms of CYP2C9 and VKORC1 results in decreased requirement of daily maintenance dose of acenocoumarol.
23469989 genetic association studies in a Han population in China: Data suggest that there are no associations between drug-induced liver injury due to antitubercular agents and 2 SNPs in CYP2C9 (rs4918758, rs9332098) in the population studied.
23446815 This study establishes phenotype-genotype correlation, and proposes to use genotyping or phenotyping to evaluate the status of drug metabolizing capacity of CYP2C9
23376925 These data suggest that promoter region polymorphisms inherited with 449G>A decrease CYP2C9 expression and contribute to CYP2C9*8 effects on warfarin clearance and dose requirements
23358499 frequency of CYP2C9*2 was lower in Amerindians than in European populations, and higher than their Asian ancestors. The presence of this allele in ethnic groups in Mexico can be explained by European admixture
23348161 CYP2C9*2 and CYP2C9*3 polymorphisms were related to the increase of excessive anticoagulation and bleeding risk in the patients who used warfarin.
23279643 Letter: CYP2C9 and VKORC1 genotypes both have a significant effect on the anticoagulation response at an early stage of warfarin initiation in children.
23201087 Large interindividual variability in acenocoumarol maintenance dose due to CYP2C9*2, CYP2C9*3 and VKORC1 -1639G>A polymorphisms.
23183958 In children with heart disease, factors which did not influence warfarin dose included CYP2C9 polymorphism.
23171336 The metabolic ratio (mean +/- standard deviation) was higher (p < 0.05) in CYP2C9*1/*3 carriers.
23159639 the stable therapeutic dose of acenocoumarol is dependent of patient's age, the presence of the CYP2C9*3 allele and c.-1639G>A polymorphism of VKORC1.
23159358 Young epileptic patients with the CYP2C9 gene polymorphism have a low risk of subclinical atherosclerosis.
23145098 CYP2C9 may not be associated with colorectal cancer development
23118231 The substrate-binding cavity of P450 2C8 is much larger than that of P450 2C19 and P450 2C9.
23113310 CYP2C9 and VKORC1 gene polymorphisms are not essential for bleeding development under conditions of oral application of anticoagulant acenocoumarol in Russian patients at high risk of thromboembolic complications.
23099353 There were no differences in VPA dose or adjusted plasma VPA concentrations among the UGT2B7*2 or CYP2C9*3 genotypic groups.
23089473 Hypoxia-inducible CYP2C9 expression is responsible for doxorubicin resistance of cancer stem cells under hypoxic conditions.
23081704 Descriptive Statement This study reveals no association between the metabolic profiles of CYP1A2, CYP2C9, CYP2C19 and CYP2D6 genes and both current suicide risk and personal history of suicide attempts.
23081681 CYP2C9 variants increase risk of colorectal adenoma recurrence and modify associations with smoking but not aspirin treatment.
23065265 The VKORC1 1639 G>A and CYP2C9 mutation prevalence and allele frequency of the current results from two different populations (Sivas and Canakkale) showed similarly very variable profiles when compared to the other results from the Turkish population.
22952875 Influence of CYP2C9 and VKORC1 on patient response to warfarin, is reported.
22941809 CYP2C9*3(1075A>C), MDR1 C3435T and MDR1 G2677T/A were determinants of inter-subject variability in fluvastatin pharmacokinetics in healthy Chinese volunteers
22918969 The expression of CYP2C9 in the liver also resulted in viable animals active in the metabolism and disposition of a number of CYP2C9 substrates.
22855348 For low-dose warfarin treatment, the VKORC1-1639 G > A and CYP2C9 genotype variations affected the pharmacokinetics and pharmacodynamics of warfarin.
22854539 Functional polymorphisms in CYP2C9, CYP4F2 and VKORC1 genes affect response to warfarin dose in an admixed Omani patient cohort.
22842957 Both SLCO1B1 521 T>C and the CYP2C9*3 polymorphisms can significantly affect the pharmacokinetics of nateglinide.
22808915 CYP2C9 and VKORC1 polymorphisms are differently distributed according to self-declared ethnicity or genetic ancestry in the Brazilian general population plus Amerindians
22735459 Report effects of CYP2C9*1/*3 and *1/*13 on the pharmacokinetics of losartan and its active metabolite E-3174 in Korean subjects.
22641027 Present findings support the previously established relationship between CYP2C9 and CYP2C19 genetic polymorphisms and the increased risk to develop PTH toxicity
22589111 Using chipCE, we present an optimization for allele separation of CYP2C19 I331V, CYP2C9 R144C, and CYP2C9 I359L polymorphisms employing run temperatures of up to 55 degrees C.
22571356 Polymorphisms in VKORC1 have more impact than CYP2C9 polymorphisms on early warfarin International Normalized Ratio control and bleeding rates.
22547083 POR genetic variants affect CYP2C9 activities. The impact of a POR variant on catalysis varies with the isoform of CYP2C9 and the assay substrate
22534826 Report algorithm predicting warfarin dose in Chinese Han patients with valvular atrial fibrillation based on CYP4F2/CYP2C9/VKORC1 polymorphisms.
22533669 Data indicate that VKORC1 TT and CYP2C9*2\*2 were associated with a significantly lower warfarin dose.
22528326 The multiple linear regression model including VKORC1-1639G>A, CYP2C9, CYP4F2 and clinical factors (body surface area (BSA) and age) could explain 42 % of the variance in the warfarin maintenance dose.
22452429 The researchers evaluated the prevalence of the CYP2C9 polymorphism in a population of Omanis.
22409277 There are no interactions between the CYP2C9 and VKORC1 genotypes affecting the maintenance dose, time to severe over-anticoagulation and time to achieve stability for phenprocoumon and acenocoumarol.
22393834 The frequency of *3-allele in CYP2C9*3 was low in Bai Tibetan chinese
22378156 The Arg150His variant protein expressed by the CYP2C9*8 allele is associated with lower S-warfarin clearance in African-American patients.
22294058 SNP 4 IVS8-109T allele is associated with a higher CYP2C9 metabolic ratio in healthy Swedish subjects.
22290467 The frequencies of CYP2C9 and VKORC1 alleles found in an Argentinian population are similar to those reported in other populations of Caucasian origin
22289258 Identification of a promoter variable number tandem repeat polymorphism that fully accounted for allelic CYP2C9 mRNA expression differences.
22288731 The result of the present study showed that the two inactive alleles of CYP2C9 accounted for 22% of CYP2C9 alleles in our sample versus 1.5%-29% reported in other populations.
22272893 summary of present knowledge of genetic variation in cytochrome P450 1B1 and 2C9 genes and risk of tobacco-related cancer, estrogen-related cancer, chronic obstructive pulmonary disease, and ischemic vascular disease [REVIEW]
22252093 Knowledge of the patient's CYP2C9/VKORC1 genotype might assist physicians in adjusting acenocoumarol doses in the first month(s) of therapy.
22198820 The present study indicated that VKORC1, CYP4F2, and CYP2C9 genotypes and interacting drugs had a significant impact on the warfarin maintenance dose in Chinese patients with heart valve replacement
22188360 All patients carried two copies of CYP2C9 by multiplex ligation-dependent probe amplification and no exon 8 deletion carriers were detected. Similarly.
22108774 Data from pharmacokinetic/drug interactions studies suggest that CYP2C9 but not CYP3A4 participates in zafirlukast metabolism.
22075505 These findings suggest that a lower initial and maintenance dose should be considered for the patients with CYP2C9 *3 allele and advanced age in this patient population.
22075408 Study of CYP2C9 allelic variants shows influence of clopidogrel-mediated platelet inhibition as assessed by platelet function tests.
22023024 warfarin response in Chinese ... in the allelic frequencies of CYP2C9
21985811 CYP2C9 genetic variants involved in the modulation of epilepsy pharmacotherapy, confirming the important role of CYP2C9 mutants preventing epilepsy patients from developing drug resistance.
21977947 CYP2C-poor metabolizers (two defective alleles) are rare (<1%) or absent in Guarani in Brazil, whereas intermediate metabolizers (one defective allele) of CYP2C19, CYP2C9 and CYP2C8 substrates account for 11%, 5.5% and 0.6%, respectively, of the cohort
21883387 Impact of genetic factors (VKORC1, CYP2C9, CYP4F2 and EPHX1) on the anticoagulation response to fluindione
21861665 CYP2C9 was 5 polymorphisms and greater than 50% of the population carried polymorphisms in either two or all of the CYP2C9, CYP2C19 and CYP2D6 genes.
21852944 From multiple coarse grained molecular simulations with arbitrary configurations of protein-membrane complexes, found two predominant orientations of CYP2C9 in the membrane, both consistent with experiments and conserved in atomic-resolution simulations.
21798861 These results suggest that there is no notable influence of sequence variation in the CYP2C genes on longevity in the examined German population
21786578 CYP2C9 and VKORC1 polymorphisms affect suppoting dose of warfarin and rate of hemorrhage in patients with venous thromboembolic complications in Moscow population.
21768671 CYP2C9 polymorphism is associated with treatment response in head and neck cancer.
21766908 described drug abuse cases suggest that an association between the presence of CYP2C and VKORC1 allelic variants and cocaine-induced interstitial lung damage is highly likely
21757329 This study demonstrated that PSP can competitively inhibit tolbutamide 4-hydroxylation in both pooled human liver microsomes and specific human CYP2C9 in vitro.
21725053 After adjustment for covariates, time to stable anticoagulation was not influenced by VKORC1 or CYP2C9 genotype.
21692828 Patients commencing warfarin treatment are at risk of bleeding due to excessive anticoagulation caused by overdosing. The dose requirements is influenced by polymorphisms in genes mediating warfarin pharmacology
21691805 CYP2C9 polymorphisms leading to decreased enzyme activity show a modest impact on the risk of mild hypoglycaemia attacks during oral antidiabetic treatment, with a significant association in patients treated with gliclazide
21651319 Pharmacogenetics of coumarin dosing: prevalence of CYP2C9 and VKORC1 polymorphisms in the Lebanese population.
21639946 CYP2C9 and VKORC1 genetic variants as well as non-genetic factors such as age, body weight and body height account for 15.4% of variance in warfarin dose among our study population.
21638223 Extreme sensitivity to acenocoumarol therapy in patient with both VKORC.-1639 A/A and CYP2C9*1/*3 genotypes.
21605066 we tested known probe substrate for these enzymes, which included 12 substrates of CYP3A4 and 18 substrates of CYP2C9 and CYP2D6 were analyzed by each software and the results were compared.
21597400 systematic review to assess all the available evidence on risk of suffering from gastrointestinal haemorrhge associated with NSAID use among carriers of loss of function variants of the gene which codes for enzyme CYP2C9 (CYP2C9*2 and CYP2C9*3)
21544933 CYP2C9 and VKORC1 gene polymorphism is not associated with the development of severe hypocoagulation episodes in patients treated with acenocoumarol.
21537551 The role of CYP2C9 polymorphism influence on phenytoin adverse reaction remains to be determined since some literature evidence and our data found negative results.
21493749 These results indicate that estrogen receptor alpha and its ligands play an important role in the regulation of CYP2C9 expression.
21451434 CYP2C9 gene mutation is associated with warfarin hypersensitivity.
21375401 Haplotype structures of common variants of CYP2C9,genes in a South Indian population
21371265 metabolism of most of the CYP2C9 substrates decreases in varying degrees in subjects carrying the CYP2C9 *2 or *3 allele
21334530 The use of higher clopidogrel doses can attenuate the effect of CYP2C19 loss-of-function variants.
21292004 NCOA6 is responsible for the synergistic activation of CYP2C9 by HNF4alpha and pregnane X receptor and NCOA6 differentially regulates CYP2C9 and CYP3A4 gene expression though both the genes are regulated by the same nuclear receptors.
21248432 VKORC1 -1639 G>A allele is present at moderately high frequency in the Northern Indian population, and frequencies of CYP2C9*2 and CYP2C9*3 alleles are also found to be different from other populations
21215088 Both gene polymorphisms of CYP450 2C9*3 + 1075C/A and VKORC1-1639A/G significantly affected the maintaining dose of warfarin in the Chinese population.
21213107 There was no overrepresentation of the CYP2C9 *2/*2, *2/*3, and *3/*3 variants in the sulfonylurea-induced hypoglycemia group (2%) compared with the control group (5%).
21173785 Report impact of population diversity on the distribution of CYP2C9 polymorphisms among Brazilians.
21167292 Esophageal cancer proliferation is mediated by cytochrome P450 2C9 (CYP2C9)
21160360 no data in humans currently provides a direct link between CYP2C9 variants and blood pressure response to dietary salt intake
21148049 This study showed that both CYP2C9 and VKORC1 polymorphisms are common in Lebanon and influence warfarin and acenocoumarol dose requirements, with the CYP2C9*2 polymorphism having less effect on acenocoumarol.
21110192 VKORC1 and CYP2C9 polymorphism contribute to the difference dose requirement amongst the patients .
21108610 CYP2C9*2, CYP2C19*2, and CYP2D6*4 polymorphisms do not appear to play a role in type 2 diabetes mellitus
21071160 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
21068649 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21063236 Phenprocoumon maintenance dosage depended on polymorphisms in the VKORC1 gene. CYP2C9 and CYP4F2 were of modest relevance.
21063236 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21057703 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21047199 There is no cardiovascular risk associated with CYP2C9 variants in a population undergoing coronary angiography.
21047199 Observational study of gene-disease association. (HuGE Navigator)
21044367 Observational study of gene-disease association. (HuGE Navigator)
20970553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20962433 results suggest a critical role for CYP2C9 in the metabolism of benzbromarone in humans and a possible risk of toxicity in the CYP2C9*3 homozygote by lowering clearance of the drug
20962433 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20946155 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20941486 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20937634 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20930419 Patients with the VKORC1 BB haplotype and CYP2C9*1/*1 required about twice the warfarin dose compared to those with the VKORC1 AA haplotype and CYP2C9*1/*1.
20930419 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20885015 Findings indicated both similarities and differences in the distribution of polymorphic alleles of CYP2C9, CYP2C19 and VKORC1 between southern and northern Iranians
20885015 Observational study of genotype prevalence. (HuGE Navigator)
20884456 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20857895 Observational study of gene-disease association. (HuGE Navigator)
20854800 Observational study of genetic testing. (HuGE Navigator)
20852447 detected an overall effect of CYP2C9*3 on lower plasma renin activity, but not on salt-sensitive BP regulation in normotensive men
20852447 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20845310 Data found that the allele frequencies of the CYP2C9*2 and CYP2C9*3 allelic variants in the studied Mongolian population of China were similar to those reported for other Asian populations.
20845310 Observational study of genotype prevalence. (HuGE Navigator)
20842355 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20833980 Polymorphisms in CYP2C9 is not associated with dosing of vitamin K antagonists in thrombosis.
20833980 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20833683 Variant alleles of this gene increase the risk of stent thrombosis in patients on dual aspirin and clopidogrel therapy after PCI
20833683 Observational study of gene-disease association. (HuGE Navigator)
20833655 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20831536 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20831047 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20815369 Size-exclusion chromatography and UV-visible absorbance spectroscopy of CYP2C9 R108H monomers demonstrated that nitrogen ligation is indeed intramolecular.
20811787 Observational study of gene-disease association. (HuGE Navigator)
20808793 CYP2C polymorphism was not associated with patent ductus arteriosus response to ibuprofen
20808793 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20733952 Observational study of genetic testing. (HuGE Navigator)
20722625 Report co-expression of recombinant human CYP2C9 with human cytochrome P450 reductase in protease deficient S. cerevisiae strain at a higher scale yields an enzyme of higher specific activity.
20716240 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20709439 Decreased kidney function was associated with lower warfarin dose requirements independently of CYP2C9 and VKORC1 genotype and clinical factors.
20709439 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20677151 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20665013 CYP2C19*17 is a frequent genetic variant in Nordic populations that exists in strong linkage disequilibrium with wildtype CYP2C8*1 and CYP2C9*1 alleles, which makes it a determinant for a haplotype exhibiting an efficient CYP2C substrate metabolism
20665013 Observational study of genotype prevalence. (HuGE Navigator)
20656072 Data show that CYP2A6 and CYP1A2 have the least malleable active sites while those of CYP2D6, CYP2C9 and CYP3A4 have considerably greater degrees of flexibility or malleability.
20653676 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20653674 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20637959 CYP2C9, and VKORC1 had significant effects on warfarin maintenance dose requirements.
20637959 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20615525 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602621 The role of CYP2C9*2 and CYP2C9*3 in attenuation of 4-ene-VPA formation cannot be confirmed.
20602621 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20602612 Observational study of gene-disease association. (HuGE Navigator)
20597268 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20585834 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20585445 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20569971 Letter: Algorithms using clinical and genetic data (CYP2C9, VKORC1) are relevant to predict warfarin dose in patients with different INR targets.
20569971 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20555338 four genetic polymorphisms known to influence warfarin dosing (VKORC1 rs9923231, CYP2C9 rs1799853, CYP2C9 rs1057910 and CYP4F2 rs2108622)
20555338 Observational study of genotype prevalence. (HuGE Navigator)
20553802 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20529763 Observational study of gene-disease association. (HuGE Navigator)
20504253 Observational study of genotype prevalence. (HuGE Navigator)
20499136 Significant associations with warfarin dose were seen for VKORC1 -1639, CYP2C9*2 and *3, the CYP4F2 SNP, and VKORC1 3730
20488169 Observational study of genotype prevalence. (HuGE Navigator)
20459744 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20459419 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20458343 Considering that CYP2C9*2 and CYP2C9*3 alleles have altered catalytic activities relative to CYP2C9*1, the present data suggest the need for pharmacogenetic studies to optimize drug dosages in different populations.
20458343 Observational study of genotype prevalence. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20445534 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20442691 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
20437850 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20436375 Observational study of gene-disease association. (HuGE Navigator)
20434758 The study examines the distribution of the minor VKORC1 and CYP2C9 alleles in a population of patients with hepatic or portal vein thrombosis.
20434758 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20430047 Observational study of gene-disease association. (HuGE Navigator)
20421126 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20390258 Observational study of gene-disease association. (HuGE Navigator)
20386359 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20381283 Observational study of gene-disease association, gene-environment interaction, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
20376629 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20375999 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20375710 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20373852 Observational study of gene-disease association. (HuGE Navigator)
20359257 Observational study of genetic testing. (HuGE Navigator)
20354686 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
20339978 VKORC1 genotype and CYP2C9 polymorphism affect daily dose requirements and time to therapeutic INR in Turkish patients receiving warfarin for anticoagulation.
20339978 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20339191 Observational study of gene-disease association, gene-environment interaction, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
20297661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20235787 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20228265 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20226775 Observational study of genetic testing. (HuGE Navigator)
20210733 Observational study of genotype prevalence. (HuGE Navigator)
20207952 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20204461 Observational study of gene-disease association, gene-environment interaction, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
20179710 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20173083 Observational study of genotype prevalence. (HuGE Navigator)
20167002 In this review, three nuclear receptors mediate the CYP2C9 gene induction in man.
20150829 Genetic phenotypes and adverse drug reactions. Review.
20149073 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20147896 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20136364 Observational study of genetic testing. (HuGE Navigator)
20131310 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20121287 Genotyping of four SNPs for VKORC1 and CYP2C9 polymorphisms is useful in predicting a high probability of the occurrence of DAH in patients receiving oral anticoagulants.
20117066 No association between any of the CYP2C9 genotypes and risk of tobacco-related cancer, individual tobacco-related cancers, or all cancer was seen.
20117066 Observational study of gene-disease association. (HuGE Navigator)
20102361 Observational study of gene-disease association. (HuGE Navigator)
20089352 The presently evaluated variant alleles in the CYP2A6, CYP2B6, and CYP2C9 genes may explain part of the substantial variability in VPA pharmacokinetics between different subjects
20089352 Observational study of gene-disease association. (HuGE Navigator)
20088379 Observational study of gene-disease association. (HuGE Navigator)
20075209 Observational study of genetic testing. (HuGE Navigator)
20073138 Observational study of genotype prevalence. (HuGE Navigator)
20072124 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20064729 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20043560 The prevalence of CYP2C9 *1/*1 is high while the prevalence of CYP2C9*2 and CYP2C9*3 is very low in patients with valvular heart disease who take warfarin.
20043560 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20031551 Observational study of gene-disease association. (HuGE Navigator)
20029944 Observational study of gene-disease association. (HuGE Navigator)
20020283 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19995889 data strongly suggest an involvement of liver-specific transcription factor GATA-4 in the transcriptional regulation of CYP2C9
19958090 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19954515 Allele frequency distributions for CYP2C9 among the Ghanaian population are comparable to other African ethnic groups but significantly differ from Caucasian and Asian populations
19954515 Observational study of genotype prevalence. (HuGE Navigator)
19952982 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19942260 Gene polymorphisms of VKORC1 significantly associated with the variation of interindividual warfarin dose requirement variation, and the effects are different in ethnicities.
19941044 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19935798 Frequencies of CYP2C8/9 polymorphisms in breast cancer patients were similar to healthy European populations.
19935798 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19934793 variant allele CYP2C9*3 associated with platelet response to clopidogrel
19934793 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19934028 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19926050 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19925388 clinical significance of cytochrome P450 2C9 gene polymorphisms (Review)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19903527 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19899329 Results describe the pharmacogenetic effects of CYP2C9 polymorphism on warfarin sensitivity in patients who are on warfarin treatment.
19899329 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19891554 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19891553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19881396 The results imply that utilizing information about the slower therapeutic response in patients with a CYP2C9 variant may improve the effectiveness of warfarin dosing intervention.
19874474 Although CYP2C9 and VKORC1 genotypes were significant independent predictors of therapeutic dose at each weekly interval, the magnitude of their predictive ability diminished over time.
19874474 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19847408 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19833260 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19823875 Studies indicate that of the 200 most clinically used drugs, 73% require metabolism and 72% of the enzymes responsible are members of the P450 superfamily, predominantly CYP3A4, CYP2D6, CYP2C19, CYP2C9, and CYP1A2.
19822571 The researchers found evidence of an increased risk for non-Hodgkin's lymphoma in women who used hair dye before 1980 and who were carriers of the CYP2C9 Ex3-52C>t TT/CT genotypes.
19822571 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19794411 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19761366 CYP2C19*17 allele determines antimalarial biguanide metabolic profile at the CYP2C19/CYP2C9 locus
19761366 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19745563 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19736056 Observational study of gene-disease association. (HuGE Navigator)
19706858 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19696793 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19669737 Preliminary results suggest a possible influence of CYP2C9 genotype on proteinuria and blood pressure in Caucasian CKD patients treated with losartan.
19669737 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19663817 M-2 and M-5 are formed preferentially by CYP2C9, and that M-3 is mainly formed by CYP3A
19663669 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19652664 Found no association between CYP2C9(*)2/3 polymorphisms and risk of subclinical atherosclerosis, ischemic vascular disease or death after ischemic heart disease.
19652664 Observational study of gene-disease association. (HuGE Navigator)
19617466 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19615687 Observational study of gene-disease association. (HuGE Navigator)
19605743 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19604036 the presence of the CYP2C9*13 allele results in poor metabolism of losartan after a single oral dose.
19604036 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19593208 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19593168 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19593158 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19581657 A reduced risk of colorectal cancer was observed in individuals who used NSAIDs for more than a year and in carriers of a CYP2C9 variant allele associated with lower enzymatic activity.
19578179 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19567378 A stepwise multivariate linear regression analysis showed that 38.2% of the warfarin dose response variance was accounted for by a model involving age (20.9%), VKORC1-1639G/A (11.3%), and CYP2C9*1, *2, and *3 variants (7.1%)
19546880 Observational study of genotype prevalence. (HuGE Navigator)
19545555 Observational study of genetic testing. (HuGE Navigator)
19541829 catalytic activities of seven alleles found in Japanese individuals were assessed using three substrates (diclofenac, losartan, and glimepiride).
19541511 prevalence of variant CYP2C9 alleles in the Hungarian population is similar to other European populations. The Roma population differs from Hungarians, from most of other Caucasian groups, and from Indians in the incidence of CYP2C9 common variants.
19541511 Observational study of genotype prevalence. (HuGE Navigator)
19538885 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19538716 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19534586 towards form-selective substrates. Rates of diclofenac 4 -hydroxylation by P450 2C9 and luciferin H-EGE metabolism by P450 2C19 were higher for the MALLLAVFL-modified forms compared with the (delta 3-20) truncated forms
19495518 The researchers found evidence of CYP2C*1,*2, and *3 alleles among healthy, unrelated subjects, but warfarin-treated diseased patients had only the CYP2C9*1 and *3 alleles.
19495518 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19480553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19474452 Observational study of genetic testing. (HuGE Navigator)
19450127 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19448135 CYP2C9-CYP2D6 interactions can alter catalytic activity and, thus, influence in vitro-in vivo correlation predictions.
19424794 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19415824 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19415745 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19414633 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19387626 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19381164 Report prevalence of CYP2C9 polymorphisms in the south of Europe.
19381164 Observational study of genotype prevalence. (HuGE Navigator)
19381162 Observational study of genotype prevalence. (HuGE Navigator)
19369937 CYP2C9 activity is modulated by exogenous factors such as the inherited CYP2C9 genotype; for the individual patient, the genotype effect may be of predominant importance.
19369937 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19350405 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19337788 Clopidogrel patients presenting with repeat acute coronary syndrome do not have higher frequency of CYP2C9 variant alleles compared to a control group.
19337788 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19324988 Observational study of genetic testing. (HuGE Navigator)
19319511 The data suggest a minor role of CYP2C9 variants in the anticoagulation property of phenprocoumon.
19319511 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19300499 warfarin dose variance is explained by single nucleotide polymorphisms in VKORC1, CYP2C9, and CYP4F2
19300499 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19297219 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19290787 Observational study of genotype prevalence. (HuGE Navigator)
19280158 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19258521 Data provide the first experimental evidence for a role of the F-G loop region in dictating the catalytic orientation of substrates within the CYP2C9 active site.
19233910 Observational study of genetic testing. (HuGE Navigator)
19233181 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19225451 Each CYP2C9*2 and CYP2C9*3 variant allele that is present reduces the required dosage of anticoagulants by 1.8 mg/week.
19225451 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19223558 Observational study of gene-disease association. (HuGE Navigator)
19221727 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19207028 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19202563 Hepatic CYP2C9 is differentially regulated by agonists of CAR and PXR.
19199010 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19192051 Observational study of gene-disease association. (HuGE Navigator)
19181737 Observational study of genetic testing. (HuGE Navigator)
19177029 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19164093 Observational study of genotype prevalence. (HuGE Navigator)
19151603 Pharmacogenetic variation at CYP2C9 in different population groups.
19139476 CYP2C9 single nucleotide polymorphisms (SNPs) have been identified that clearly influence warfarin metabolism and sensitivity, including CYP2C9 variants that influence an individual's sensitivity to a given dose of warfarin.
19136640 These feasibility data suggest that the [(13)C]pantoprazole breath test is a reliable, rapid, and noninvasive probe of CYP2C19
19135231 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19117406 Observational study of genetic testing. (HuGE Navigator)
19106084 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19099951 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19082874 Theoretical method estimated the quantitative changes in pharmacokinetics of CYP2C9 substrates in subjects with mutated alleles of CYP2C9.
19077919 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19074728 much of the information provided by CYP2C9 and VKORC1 genotypes during warfarin initiation is captured by the early international normalized ratio response
19074728 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19053752 analysis of how CYP2C9 type II substrate binding affinity is determined by the combination of steric, electrostatic, and hydrophobicity factors
19031075 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19026171 Results describe the inhibitory potential of 2 new fluoroquinolones, caderofloxacin and antofloxacin, together with 4 marketed fluoroquinolones, on the activity of cytochrome P450 isoforms 1A2 (CYP1A2) and 2C9 (CYP2C9).
19018719 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19010418 Observational study of genotype prevalence. (HuGE Navigator)
19005461 The CYP2C9*3 variant may influence both the therapeutic and adverse effects of 9-tetrahydrocannabinol (THC) in 43 healthy volunteers.
19005461 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18992346 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18992263 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18992148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18990750 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18971529 CYP2C9*30 might be associated with a diminished response to the antihypertensive effects of losartan in hypertension
18971529 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18950464 The risk of gastrointestinal bleeding during acenocoumarol therapy in carriers of any of the studied polymorphisms is severely increased with exposure to weekly doses of acenocoumarol higher than 15 mg or the use of amiodarone or aspirin.
18950464 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18922023 The data demonstrate that F114 and F476, but not F100, influence ( S)-warfarin's catalytic orientation. Differential interactions of F476 mutants with the two substrates suggest that their catalytically productive binding modes are not superimposable.
18855533 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18854779 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18836275 Patients with CYP2C9*1/*3 and CYP2C9*2/*3 genotypes needed a lower maintenance dose of warfarin than patients with CYP2C9*1/*1 wild-type genotype.
18836275 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18816302 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18793590 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18781852 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18756910 bleeding as a complication of warfarin therapy with polymorphism of CYP2C9 gene (alleles 1, 2 and 3).
18756910 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18754597 Benzene hydroxylation is investigated in the realistic enzyme environment of the human CYP 2C9 by using quantum mechanical/molecular mechanical calculation using the reaction profile.
18754001 Observational study of gene-disease association. (HuGE Navigator)
18698879 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18694831 Metabolism of racemic, S-ibuprofen and R-ibuprofen in CYP2C9*3; an increased R-ibuprofen metabolism in CYP2C8*3; and fewer adverse events in CYP2C8*3 volunteers are suggested
18690342 genetic variation in VKORC1 appears to have a different influence than CYP2C9 on anticoagulation-related outcomes such as bleeding events and time in therapeutic range of warfarin
18690342 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18681789 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18680736 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18669935 Cytochrome P-450 2C9 signaling does not contribute to age-associated vascular endothelial dysfunction in humans.
18662264 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18629445 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18597650 Observational study of gene-disease association. (HuGE Navigator)
18574025 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18570163 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18559094 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18552123 The coactivator NCOA6 mediates the mechanism of the synergistic activation of the CYP2C9 gene by CAR and HNF4alpha.
18548238 The present study was aimed at analyzing the role of both CYP2C8 and CYP2C9 genotypes on diclofenac metabolism, as well as determining the the CYP2C8 gene frequency and its relationship with CYP2C9 variants.
18548238 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18542936 CYP2C9 polymorphisms are associated with warfarin dose requirements in Turkish patients.
18542936 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18535201 Warfarin dosing is correlated with polymorphisms in VKORC1 and the CYP2C9 genes
18535201 Genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18516070 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18511451 analysis of amino acid residues that confer CYP2C19 selective activity to CYP2C9
18510611 Observational study of gene-disease association. (HuGE Navigator)
18496682 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18496133 no association between variation in CYP2C8 or CYP2C9 and myocardial infarction or stroke
18496133 Observational study of gene-disease association. (HuGE Navigator)
18496131 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18485885 Substrate proton to heme distances in CYP2C9 allelic variants and alterations by the heterotropic activator dapsone are reported.
18480003 Observational study of genetic testing. (HuGE Navigator)
18466099 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18429757 Cytochrome P450 2C9 gene polymorphism influences frequency of development of hemorrhagic complications, metabolic clearance, and magnitude of warfarin maintenance dose.
18429757 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18425152 Observational study of genotype prevalence. (HuGE Navigator)
18419640 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18399713 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18378563 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18375260 study of the CYP2C9*2 and CYP2C9*3 allelic frequencies in a sample of 100 healthy third-generation Mexican subjects
18370846 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18356043 Data concluded that CYP2C9, CYP2C19 and CYP3A4 are the primary cytochromes in the bioactivation of lynestrenol in vitro, while CYP3A4 catalyses the further metabolism of norethindrone.
18340006 EphB4 is a critical component of the CYP2C9- and 11,12-EET-activated signaling cascade that promotes angiogenesis in vitro as well as in vivo.
18322281 Initial variability in the INR response to warfarin was more strongly associated with genetic variability in the pharmacologic target of warfarin, VKORC1, than with CYP2C9.
18322281 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18315785 Observational study of genetic testing. (HuGE Navigator)
18310303 Genetic variation within CYP2C9 regulatory sequences is likely to contribute to differences in CYP2C9 phenotype both within and among different populations.
18305455 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18303964 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18281915 Observational study of pharmacogenomic / toxicogenomic and genetic testing. (HuGE Navigator)
18252229 Observational study of genotype prevalence. (HuGE Navigator)
18240905 Among American Jews, the CYP2C9*1, *2, *3 and *5 allele frequencies were 0.772, 0.140, 0.086 and 0.002, respectively, and the genotypes were distributed into extensive, intermediate and porr metabolizer phenotypes.
18240905 Observational study of genotype prevalence. (HuGE Navigator)
18240903 Observational study of genotype prevalence. (HuGE Navigator)
18231117 Observational study of gene-disease association. (HuGE Navigator)
18216720 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18211048 QSAR analysis for substrate specificity of six CYP isoforms, revealing that CYP2C9 substrates are anionic compounds, while CYP2D6 substrates are cationic, and CYP2E1 substrates are smaller compounds, while CYP3A4 substrates are larger compounds
18204476 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18183038 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18154472 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18061941 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18034619 CYP2C9*2 (Arg144Cys) and CYP2C9*3 (Ile359Leu) variant alleles were significantly associated with low mean weekly warfarin dose.
18034619 Observational study of gene-disease association. (HuGE Navigator)
18034618 Multiple regression analysis revealed that CYP2C9 genotype (p = 0.015), age (p < 0.001) and body surface area (p < 0.001) were jointly associated with warfarin dose requirements in African-Americans.
18030307 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18024866 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18021343 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17989110 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17955230 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17900275 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17900275 Common loss of function polymorphisms of CYP2C19 and CYP2C9 are associated with decreased exposure to the active metabolite of clopidogrel but not prasugrel.
17899045 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17895500 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17895500 study compared the frequency of variant CYP2C9 alleles and warfarin S/R concentration ratio in patients who required low-dose (<2.5 mg/day) and average-dose (5+/-0.5 mg/day) warfarin
17868191 Smoker patients having CYP2C9*2 heterozygote genotype have 3.7-fold risk of developing atherosclerosis. CYP2C19*3 heterozygote alleles are more frequent in patients than in controls and it is related with a three-fold risk of atherosclerosis.
17868191 Observational study of gene-disease association. (HuGE Navigator)
17851566 Clinical trial of pharmacogenomic / toxicogenomic and genetic testing. (HuGE Navigator)
17849045 Cyp2C9 genotype affects coumarin metabolism.
17827526 A point mutation in CYP2C9 gene is associated with hepatic carcinogenesis.
17827141 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17764537 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17721328 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17721328 CYP2C9*2 C/T, CYP2C9*3 A/C, VKORC1 (-1639) G/A genotyping might be necessary for patients with Factor V Leiden and/or prothrombin G2021A mutation before warfarin anticoagulant therapy.
17686967 These results suggest that in addition to coupling differences, differential uncoupling to shunt products and differences in spin state help explain the reduced catalytic activity in CYP2C9 polymorphic variants.
17681167 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17681167 CYP2C9*3 allele was associated with a significant high risk of gastrointestinal bleeding during treatment with non-steroidal antiinflammatorys metabolized by CYP2C9.
17653141 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17653141 In patients on warfarin CYP2C9 genotype is associated with an increased risk of major hemorrhage, which persists even after stabilization of therapy.
17635185 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17635185 The present findings provide preliminary evidence about the greater risk of suffering MDD for individuals carrying both 5-HTTLPR-S and CYP2C9*3 alleles.
17635181 Observational study of genotype prevalence. (HuGE Navigator)
17635176 Observational study of genotype prevalence. (HuGE Navigator)
17627038 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17627038 These results suggest that alterations in CYP2C8 and CYP2C9 at the CYP2C gene locus are associated with the risk for essential tremor.
17627011 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17603219 The cloned CYP2C9 splicing variant appeared to lack the ability to catalyze reactions mediated by normal CYP2C9, and the expression level in liver ranged between 0.7 and 9.6% of the normal CYP2C9 protein.
17597710 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17597710 Patients with diabetes mellitus who are carriers of a CYP2C9*3 allele require lower doses of tolbutamide to regulate their serum glucose levels compared to patients with the wild-type genotype.
17596671 the CYP2C9*3/4 genotype has a role in response to the anticoagulant warfarin
17596133 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17577464 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17572144 CYP2C metabolites contribute to endothelium-mediated vasodilation of peripheral conduit arteries in vivo.
17562299 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17558303 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17558303 investigated whether the variant alleles CYP2C9*2 and CYP2C9*3 or the use of CYP2C9 substrates or inhibitors was associated with an increased risk of myocardial infarction
17510308 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17504998 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17479200 effect of CYP2C9 variants on warfarin clearance in Chinese patients
17460547 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17446262 Cytochrome b5 can alter multiple steps in the catalytic cycle via complex interactions with CYP2C9 and P450 reductase.
17419358 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17419358 In patients with CYP2C9*2 and CYP2C9*3 the clearance of warfarin and its dose were lower, while the episodes of excessive hypocoagulation and hemorrhage associated with warfarin were more frequent than in patients without these allelic variants.
17418993 An inhibition assay was developed and validated for CYP2C9 in liver microsomes.
17413769 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17397249 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17391071 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17368604 Observational study of gene-disease association. (HuGE Navigator)
17368604 CYP2C9 gene polymorphisms is associated with colorectal carcinoma
17332144 a novel defective CYP2C9 variant allele of potential importance for drug metabolism in vivo
17329986 Genetic polymorphisms in the CYP2C9 gene have the potential to explain some of the observed ethnic variability in drug response and to improve clinical practice (Review)
17325732 Observational study of gene-gene interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17324110 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17304159 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17301738 Observational study of gene-disease association. (HuGE Navigator)
17298483 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17279092 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17279092 no evidence to support CYP2C9 genetic polymorphisms as predictable potential risk factors for drug-induced idiosyncratic liver injury
17269966 Observational study of gene-disease association. (HuGE Navigator)
17226852 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17201743 Observational study of genotype prevalence. (HuGE Navigator)
17192772 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17192772 Data suggest that preceeding knowledge of both VKORC1 and CYP2c9 genotypes could contribute to a safer treatment with long acting anticoagulant phenprocoumon.
17178267 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17167248 Observational study of genotype prevalence and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17157122 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17111199 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17110455 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17085674 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17049586 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17049586 In addition to polymorphisms in VKORC1 and CYP2C9, we identified GGCX 8016G>A, resulting in the missense mutation R325Q, as a genetic determinant of warfarin maintenance dose in Japanese patients.
17048007 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17015052 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16985032 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16985026 Observational study of gene-disease association. (HuGE Navigator)
16969365 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16957870 comprehensive analysis of the distribution of sEH, CYP2C8, 2C9 and 2J2 in human neoplastic tissues using tissue micro-arrays
16924387 Observational study of genotype prevalence. (HuGE Navigator)
16890578 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16882880 These results establish the importance of coactivators PGC1alpha and SRC1 for the hepatic expression of human P450s and uncover a new HNF4alpha-dependent regulatory mechanism to constitutively control the CYP1A1/2 cluster.
16878445 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16873909 Observational study of gene-disease association. (HuGE Navigator)
16863464 [review] The genotype for the gene encoding therapeutic target gene vitamin K epoxide reductase is an important factor in determining vitamin K antagonist dose in patients with variant CYP2C9 alleles.
16847664 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16847429 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16815313 Observational study of gene-gene interaction and gene-environment interaction. (HuGE Navigator)
16797247 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16784736 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16771603 Observational study of genotype prevalence. (HuGE Navigator)
16749864 PXR and CAR transcription factors are regulating CYP2C9 gene expression.
16740353 Structure-activity relationship of CYP2C9*13, a CYP2C9 variant encoding a Leu90Pro substitution.
16708125 Meta-analysis of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16699986 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16676068 Observational study of gene-disease association. (HuGE Navigator)
16646575 The findings summarized in this review suggest that among individuals with Asian or European ancestry, intraethnic differences in the risk of developing adverse effects with drugs that are CYP2C8 or CYP2C9 substrates are to be expected.
16639745 Combination of mobile surface and rigid core leads to a broad substrate profile and simultaneously a high regioselectivity.
16638864 Observational study of gene-disease association. (HuGE Navigator)
16635054 Observational study of genotype prevalence. (HuGE Navigator)
16630605 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16627267 Observational study of genetic testing. (HuGE Navigator)
16611750 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16595916 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16580898 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16552506 important interaction between carbamazepine and warfarin metabolism in caucasian patients with CYP2C9*1/*1 genotype
16541193 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16538176 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16432637 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16424822 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16424822 VKORC1 and CYP2C9 polymorphisms contribute to inter-population difference in warfarin doses among Japanese, Caucasians and African-Americans
16413010 Observational study of genotype prevalence, gene-disease association, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16413010 novel intronic G-65/C mutation of CYP2C9 appears to be inter-racially different in allelic frequency
16385451 Observational study of gene-disease association. (HuGE Navigator)
16372821 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16342679 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16338275 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16325295 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16321620 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16305587 Observational study of gene-disease association. (HuGE Navigator)
16305586 Observational study of gene-environment interaction and healthcare-related. (HuGE Navigator)
16303885 Observational study of gene-disease association. (HuGE Navigator)
16297214 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16268502 Observational study of gene-disease association. (HuGE Navigator)
16253141 Current data suggest that the expression of CYP2C varies in different parts of the colon.
16236141 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16232205 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16220110 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16220110 in a Black population, CYP2C9*5, *6, *8 and *11 variants, but not CYP2C9*9, are associated with a decreased phenytoin metabolism
16202848 Observational study of gene-disease association. (HuGE Navigator)
16202848 CYP2C9*2 alleles were in strong linkage disequilibrium in both the hypertensive and healthy African American group.
16198656 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16198655 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16187974 Observational study of genotype prevalence. (HuGE Navigator)
16183265 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16160068 Clinical trial of genetic testing. (HuGE Navigator)
16160068 Rapid genetic screening for cytochrome P450 (CYP) 2C9 variants may play a role in improving the efficacy and safety of warfarin in individuals with CYP2C9 variants.
16141797 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16141794 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16116487 Observational study of gene-disease association. (HuGE Navigator)
16111713 Observational study of genotype prevalence. (HuGE Navigator)
16099926 Novel allelic variants of CYP2C9 recently discovered in Singapore were functionally characterized.
16094537 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16082538 Observational study of genotype prevalence. (HuGE Navigator)
16025294 Observational study of genotype prevalence. (HuGE Navigator)
16006997 Observational study of gene-disease association. (HuGE Navigator)
15970795 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15963101 Observational study of gene-disease association. (HuGE Navigator)
15961979 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15947090 Observational study of gene-disease association. (HuGE Navigator)
15947090 CYP2C9 and VKORC1 genotype have roles in determining response to warfarin therapy and therefore in blood coagulation
15940194 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15940194 Carriers of CYP2C9x2 and CYP2C9x3 alleles more rapidly achieved therapeutic levels of hypocoagulation and required significantly lower weekly doses of warfarin.
15924351 individuals exposed to tobacco carcinogens were at increased risk of colorectal cancer and that overall risk is related to microsomal epoxide hydrolase and CYP2C9 genotype
15919766 there is cross talk between distal CAR/PXR sites and HNF4alpha binding sites in the CYP2C9 promoter and that the HNF4alpha sites are required for maximal induction of the CYP2C9 promoter.
15900282 Observational study of gene-disease association. (HuGE Navigator)
15900281 Observational study of gene-disease association. (HuGE Navigator)
15896241 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15889670 Observational study of gene-disease association. (HuGE Navigator)
15888487 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15855721 Observational study of gene-disease association. (HuGE Navigator)
15842554 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15841315 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15824753 Observational study of gene-disease association. (HuGE Navigator)
15813658 Observational study of gene-disease association. (HuGE Navigator)
15795654 Observational study of genotype prevalence. (HuGE Navigator)
15795654 Cytochrome P450 2C9 shows genetic polymorphism with high interethnic variation; no report has addressed the genetic polymorphism in the Vietnamse population.
15790782 The simple genotyping of 2 single-nucleotide polymorphisms (SNPs), VKORC1 -1639G>A or 1173C>T and the CYP2C9*3 polymorphisms, could thus predict a high risk of overdose before initiation of anticoagulation with acenocoumarol
15776277 Observational study of genotype prevalence. (HuGE Navigator)
15776277 Polymorphism of CYP2C9 gene is involved in the metabolism of various drugs used clinically.
15742978 polymorphisms of cytochrome P450 2C9 cause reduced phenprocoumon (S)-7-hydroxylation
15714076 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, gene-environment interaction, pharmacogenomic / toxicogenomic, and healthcare-related. (HuGE Navigator)
15691505 Observational study of genetic testing. (HuGE Navigator)
15660966 Observational study of genotype prevalence. (HuGE Navigator)
15632378 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15617742 The frequency of CYP2C9 genetic variants in the Russian population and their associations with individual sensitivity to warfarin therapy were studied.
15608560 Observational study of gene-disease association. (HuGE Navigator)
15608560 The coding region polymorphisms associated with the CYP2C9 alleles are the major CYP2C9-related factor affecting warfarin dose in UK Caucasians. Upstream CYP2C9 polymorphisms appear not to be important independent determinants of dose requirement.
15606441 Observational study of genotype prevalence, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15606435 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15592327 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15588114 Observational study of gene-disease association. (HuGE Navigator)
15569819 Overexpression of CYP2C9 in endothelial cells increased cAMP levels, stimulated the cAMP-response element-binding protein, and enhanced COX-2 promoter activity, protein expression, prostacyclin production, & endothelial tube formation.
15569425 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15536456 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15452553 Observational study of genotype prevalence. (HuGE Navigator)
15452553 The frequency of the CYP2C9*2 polymorphism is lower among Mexican-Americans compared to Spaniards (P<0.05).
15385837 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15371982 Observational study of gene-disease association. (HuGE Navigator)
15370961 Of several human P450 enzymes, CYP2C9 had the greatest activity for hydroxylation of R-etodolac.
15369736 Observational study of gene-disease association. (HuGE Navigator)
15290664 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15289788 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15284536 Observational study of genotype prevalence, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15284535 Observational study of genotype prevalence. (HuGE Navigator)
15260906 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15260906 "The results of the present study show that CYP2C9 is not likely to be involved in risperidone metabolism." P. 191
15248218 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15229460 Observational study of genotype prevalence, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15226678 Novel CYP2C9 alleles correlated with reduced plasma clearance of drugs that are substrates for CYP2C9.
15222661 Observational study of genetic testing. (HuGE Navigator)
15213846 Observational study of gene-disease association. (HuGE Navigator)
15199455 Possession of the CYP2C9*2 or CYP2C9*3 variant alleles results in decreased enzyme activity and has been associated with a significant decrease in mean warfarin dose requirements.
15197523 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15177309 Observational study of genotype prevalence. (HuGE Navigator)
15177309 CYP2C9,the most abundant among human CYP2c, metabolises a number of therapeutically important drugs, including most steroidal anti-inflammatory drugs,S-warfarin, phenytoin and losartan"
15175798 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15145963 Observational study of gene-disease association. (HuGE Navigator)
15128048 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15116053 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15116052 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15102864 "Genetic polymorphism of cytochrome P450 (CYP)enzymes are one of the factors that contribute to the pharmacokinetic variability of drugs."
15100169 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15090156 Observational study of genetic testing. (HuGE Navigator)
15070684 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15070684 analysis of the -2.1-kb 5'-flanking region of CYP2C9 was undertaken in 22 white and 38 Japanese patients whose unbound oral clearance of S-warfarin had been previously determined
15066644 Observational study of gene-disease association. (HuGE Navigator)
15061384 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15050794 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15048614 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15024534 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15005635 Clinical trial of gene-environment interaction. (HuGE Navigator)
15001972 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15001971 Observational study of gene-environment interaction. (HuGE Navigator)
14739630 review of genetic variants associated with the metabolism of (S)-warfarin by cytochrome P450 2C9, and implications for increased propensity for bleeding
14726986 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14707031 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14691574 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14691573 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14676821 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14661864 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14656880 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14656880 Genotyping of CYP2C9 and certain vitamin K-dependent protein genes is useful for predicting anticoagulant (warfarin) responses.
14646690 Observational study of gene-disease association. (HuGE Navigator)
14634838 Observational study of genotype prevalence. (HuGE Navigator)
14634042 The ontogeny of CYP2C9 and -2C19 were dissimilar among both fetal and 0- to 5-months postnatal samples, implying different developmental regulatory mechanisms.
14616425 Observational study of genotype prevalence. (HuGE Navigator)
14614357 role of polymorphism of cytochrome P450 CYP2C9 as an independent risk factor modulating the sensitivity of patients to the anticoagulant effect of acenocoumarol
14583800 Observational study of gene-disease association. (HuGE Navigator)
14583800 Study shows a higher frequency of the CYP2C9*3 allele in major depressive patients compared to schizophrenic patients and healthy volunteers.
14520122 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14504850 Observational study of genotype prevalence. (HuGE Navigator)
14500040 Observational study of genetic testing. (HuGE Navigator)
12950145 Observational study of genotype prevalence. (HuGE Navigator)
12950145 The prevalence of mutations of allelic variant predict genotype frequency in the croatian populations.
12913403 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12900870 CYP2C9 and CYP2C19 provided enhanced formation of R-EDDP from methadone and CYP2D6 incubation resulted in the preferential conversion to S-EDDP.
12891229 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12891229 pharmacokinetics of both enantiomers of fluvastatin depended on the CYP2C9 genotype, but differences in plasma concentrations were not reflected in cholesterol lowering
12879168 Observational study of genotype prevalence. (HuGE Navigator)
12861225 crystal structure of a human CYP450, CYP2C9, both unliganded and in complex with the anti-coagulant drug warfarin
12844136 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12805007 Observational study of genetic testing. (HuGE Navigator)
12803577 Observational study of genotype prevalence. (HuGE Navigator)
12800253 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12734606 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12728288 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12698304 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12682803 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12668916 an examination of the promoter sequence
12634980 Observational study of gene-disease association. (HuGE Navigator)
12621390 Observational study of gene-environment interaction. (HuGE Navigator)
12603175 Clinical trial of gene-environment interaction. (HuGE Navigator)
12559973 the presence of N-hydroxydapsone caused the same effects on stoichiometry as those of flurbiprofen 4(')-hydroxylation but failed to reduce excess water formation, which suggests that, while N-hydroxydapsone activates CYP2C9, it does so less efficiently
12534640 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12509498 CYP 2C9 has role in regulation of hyperaemia and oxygen uptake during exercise. Interaction between CYP 2C9 and NOS appears to exist so that a CYP-dependent vasodilator mechanism takes over when NO production is compromised.
12496751 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12464247 CYP2C9 substrate specificity and hydroxylation depend on phenylalanine residues
12451434 Observational study of genotype prevalence. (HuGE Navigator)
12445031 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
12435384 Observational study of genotype prevalence. (HuGE Navigator)
12435384 the frequency of polymorphisms was analyzed and the number of subjects carrying both of the CYP2C8*1*3 and CYP2C9*1*2 was found to be 4.5-fold higher than expected
12426520 Observational study of gene-disease association. (HuGE Navigator)
12419832 Observational study of gene-disease association. (HuGE Navigator)
12414349 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12414349 cytochrome P450 CYP2C9 polymorphisms influence acenocoumarol dose requirements and stability of anticoagulation
12406644 structure-function relationship of the CYP2C9 promoter and coding regions [review]
12360109 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12360109 contributes to the biotransformation of E- and Z-doxepin in healthy volunteers
12359989 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12359989 CYP2C9 genotype influences the blood pressure-decreasing response to antihypertensive treatment with irbesartan
12235454 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12207635 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12181452 Regulation of human CYP2C9 by the constitutive androstane receptor: discovery of a new distal binding site.
12152005 the pharmacokinetics of racemic and of S-ibuprofen depended on the CYP2C9 isoleucine359leucine amino acid polymorphism
12047484 Observational study of genotype prevalence. (HuGE Navigator)
12010835 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12010835 2C9*3 and 2C9*2 variants of cytochrome P-450 CYP2C9 show a different sensitivity to the anticoagulant enocoumarol
11991950 expression in hepatocytes by vitamin D receptor pathway
11960920 Association of CYP2C9 genotypes leading to high enzyme activity and colorectal cancer risk.
11956512 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11926893 Observational study of gene-disease association. (HuGE Navigator)
11926893 CYP2C9*2 and CYP2C9*3 polymorphisms are associated with an increased risk of overanticoagulation and of bleeding events among patients in a warfarin anticoagulation clinic setting
11911968 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11911968 Influence of cytochrome P450 CYP2C9 genotypes in lung cancer risk.
11908757 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11893129 Observational study of gene-environment interaction. (HuGE Navigator)
11876753 Anti-cytochrome P450 autoantibodies, identified on the basis of their specific binding in immunoblots, are significantly increased among children on immunosuppressive drugs and in some cases are associated with drug toxicity and organ rejection.
11833786 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11833786 Cytochrome P4502C9 genotype in southeast anatolia and possible relation with some serum tumour markers and cytokines.
11740344 Identification of a null allele of CYP2C9 in an African-American exhibiting toxicity to phenytoin
11697742 Observational study of genotype prevalence. (HuGE Navigator)
11697742 polymorphic alleles are rare in Inuit population
11678789 Observational study of genotype prevalence. (HuGE Navigator)
11588061 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11503012 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11434505 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11422024 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11372590 Observational study of genotype prevalence. (HuGE Navigator)
11325819 Observational study of gene-disease association. (HuGE Navigator)
11298075 Observational study of genotype prevalence. (HuGE Navigator)
11186133 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11127854 Observational study of gene-environment interaction. (HuGE Navigator)

AA Sequence

MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFG      1 - 70
LKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRS     71 - 140
IEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFHKRFDYKDQQFLNLMEKLNENIKILSS    141 - 210
PWIQICNNFSPIIDYFPGTHNKLLKNVAFMKSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPS    211 - 280
EFTIESLENTAVDLFGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDA    281 - 350
VVHEVQRYIDLLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFK    351 - 420
KSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV    421 - 490
//

Text Mined References (804)

PMID Year Title
26894931 2016 Cyclophosphamide treatment-induced leukopenia rates in ANCA-associated vasculitis are influenced by variant CYP450 2C9 genotypes.
26757860 2015 [Effect of VKORC1 and CYP2C9 variants on dosage of oral anticoagulants in Chilean individuals].
26690534 2015 Characterization of drug-metabolizing enzymes CYP2C9, CYP2C19 polymorphisms in Tunisian, Kuwaiti and Bahraini populations.
26669712 2015 P450 (Cytochrome) Oxidoreductase Gene (POR) Common Variant (POR*28) Significantly Alters CYP2C9 Activity in Swedish, But Not in Korean Healthy Subjects.
26554252 2015 CYP2C9 Genetic Polymorphism is a Potential Predictive Marker for the Efficacy of Rosuvastatin Therapy.
26469104 CYP2C9 Polymorphism and Unstable Anticoagulation with Warfarin in Patients Within the First 3 Months Following Heart Valve Replacement.
26422867 2015 VKORC1 and CYP2C9 genotypic data-based dose prediction alone does not accurately predict warfarin dose requirements in some Malaysian patients.
26255664 2015 Identification and characterization of a novel CYP2C9 allelic variant in a warfarin-sensitive patient.
26122864 2015 Effect of gender and CYP2C9 and CYP2C8 polymorphisms on the pharmacokinetics of ibuprofen enantiomers.
26050796 2015 Development of a pharmacogenetic-based warfarin dosing algorithm and its performance in Brazilian patients: highlighting the importance of population-specific calibration.
26024874 2015 Race influences warfarin dose changes associated with genetic factors.
26010205 2015 Influence of CYP2C9 polymorphism on the fall in International Normalized Ratio in patients interrupting warfarin therapy before elective surgery.
25994870 2015 Association analysis of CYP2C9*3 and phenytoin-induced severe cutaneous adverse reactions (SCARs) in Thai epilepsy children.
25994031 2015 Identification and Functional Assessment of a New CYP2C9 Allelic Variant CYP2C9*59.
25967074 2015 Clinical significance of CYP2C9-status guided valproic acid therapy in children.
25958051 2015 Genetic polymorphism analysis of the drug-metabolizing enzyme CYP2C9 in a Chinese Tibetan population.
25951663 2014 The role of CYP2C9 genetic polymorphisms in the oxidative metabolism of diclofenac in vitro.
25943175 2015 Clinical relevance of genetic polymorphism in CYP2C9 gene to pharmacodynamics and pharmacokinetics of phenytoin in epileptic patients: validatory pharmacogenomic approach to pharmacovigilance.
25924705 2015 Effect of CYP2C9 Genetic Polymorphism in a Chinese Population on the Metabolism of Mestranol in vitro.
25904339 2015 Analysis of CYP2C9 polymorphisms (*2 and *3) in warfarin therapy patients in Pakistan. Association of CYP2C9 polymorphisms (*2 and*3) with warfarin dose, age, PT and INR.
25832633 2015 Impact of CYP2C9 polymorphism found in the Chinese population on the metabolism of propofol in vitro.
25823787 2015 Mechanistic insights into the effect of CYP2C9*2 and CYP2C9*3 variants on the 7-hydroxylation of warfarin.
25803758 2016 Pharmacogenetic Testing for Analgesic Adverse Effects: Pediatric Case Series.
25802328 2015 Inflammation-associated microRNA-130b down-regulates cytochrome P450 activities and directly targets CYP2C9.
25795462 2015 Short-term fasting alters cytochrome P450-mediated drug metabolism in humans.
25712887 2015 Effects of CYP2C9*1/*3 genotype on the pharmacokinetics of flurbiprofen in Korean subjects.
25712185 2015 Factors influencing pharmacokinetics of warfarin in African-Americans: implications for pharmacogenetic dosing algorithms.
25704921 2015 Suppression of CYP2C9 by microRNA hsa-miR-128-3p in human liver cells and association with hepatocellular carcinoma.
25699611 2015 Impact of CYP2C9 and VKORC1 genetic polymorphisms upon warfarin dose requirements in Egyptian patients with acute coronary syndrome.
25644970 2015 Association of CYP3A variants with kidney transplant outcomes.
25591012 2015 Drug modulation of water-heme interactions in low-spin P450 complexes of CYP2C9d and CYP125A1.
25560582 2015 Association of CYP2C8, CYP2C9 and CYP2J2 gene polymorphisms with myocardial infarction in South Indian population.
25560189 2015 Genotype frequencies of VKORC1 and CYP2C9 in native and Mestizo populations from Mexico, potential impact for coumarin dosing.
25552922 2015 Combination analysis in genetic polymorphisms of drug-metabolizing enzymes CYP1A2, CYP2C9, CYP2C19, CYP2D6 and CYP3A5 in the Japanese population.
25521356 2014 Genotype and risk of major bleeding during warfarin treatment.
25518510 2014 [Effect of original and generic clopidogrel on prognosis in relation to different gene polymorphisms].
25499099 2015 Novel single nucleotide polymorphism in CYP2C9 is associated with changes in warfarin clearance and CYP2C9 expression levels in African Americans.
25492821 2014 [Effect of genetic variations on adjusting of warfarin dose].
25461246 2015 Poor warfarin dose prediction with pharmacogenetic algorithms that exclude genotypes important for African Americans.
25406731 2014 Elevated 14,15- epoxyeicosatrienoic acid by increasing of cytochrome P450 2C8, 2C9 and 2J2 and decreasing of soluble epoxide hydrolase associated with aggressiveness of human breast cancer.
25391650 2015 Epigenetic modification of histone 3 lysine 27: mediator subunit MED25 is required for the dissociation of polycomb repressive complex 2 from the promoter of cytochrome P450 2C9.
25356900 2015 Combined effects of hepatocyte nuclear factor 4? and constitutive androstane receptor on stable warfarin doses.
25332267 Genetic susceptibility to hepatoxicity due to bosentan treatment in pulmonary hypertension.
25318916 2014 Frequencies of polymorphisms in CYP2C9 and VKORC1 genes influencing warfarin metabolism in Slovak population: implication for clinical practice.
25304014 2015 Effect of CYP2C9, CYP4F2 and VKORC1 genetic polymorphisms on pharmacokinetics and pharmacodynamics of mean daily maintenance dose of warfarin in Chinese patients.
25303293 2014 Relationship between the CYP2C9 IVS8-109A>T polymorphism and high losartan hydroxylation in healthy Ecuadorian volunteers.
25241292 2014 Gender and functional CYP2C and NAT2 polymorphisms determine the metabolic profile of metamizole.
25182955 2014 Diplotypes of CYP2C9 gene is associated with coronary artery disease in the Xinjiang Han population for women in China.
25155935 2014 Genetic epidemiology of pharmacogenetic variations in CYP2C9, CYP4F2 and VKORC1 genes associated with warfarin dosage in the Indian population.
25142093 2014 Influence of proton pump inhibitors and VKORC1 mutations on CYP2C9-mediated dose requirements of vitamin K antagonist therapy: a pilot study.
25121365 Association of polymorphisms of CYP2C9, CYP2C19, and ABCB1, and activity of P-glycoprotein with response to anti-epileptic drugs.
25099164 2014 Clinical pharmacogenetics implementation consortium guidelines for CYP2C9 and HLA-B genotypes and phenytoin dosing.
25096692 2014 Genetic variants associated with phenytoin-related severe cutaneous adverse reactions.
25041257 2014 Risk factors of symptomatic NSAID-induced small intestinal injury and diaphragm disease.
24986093 2014 Drug-drug interaction of losartan and glimepiride metabolism by recombinant microsome CYP2C9*1, 2C9*3, 2C9*13, and 2C9*16 in vitro.
24978953 2016 VKORC1 and CYP2C9 genotypes in Egyptian patients with warfarin resistance.
24974237 2014 Prevalence of genetic polymorphisms of CYP2C9 and VKORC1 - implications for warfarin management and outcome in Croatian patients with acute stroke.
24966969 2014 High resolution melting method to detect single nucleotide polymorphism of VKORC1 and CYP2C9.
24962733 2015 Meta-analysis of randomized controlled trials reveals an improved clinical outcome of using genotype plus clinical algorithm for warfarin dosing.
24960263 2014 Med25 is required for estrogen receptor alpha (ER?)-mediated regulation of human CYP2C9 expression.
24956252 2014 Effect of VKORC1, CYP2C9 and CYP4F2 genetic variants in early outcomes during acenocoumarol treatment.
24956244 2014 Warfarin dose requirements in a patient with the CYP2C9*14 allele.
24919870 2014 Pharmacogenetics role in the safety of acenocoumarol therapy.
24917142 2014 The role of cytochrome P450 epoxygenases in retinal angiogenesis.
24911077 2014 CYP2C9, VKORC1, CYP4F2, ABCB1 and F5 variants: influence on quality of long-term anticoagulation.
24889181 2014 CYP2C9 allelic variants and frequencies in a pediatric sickle cell disease cohort: implications for NSAIDs pharmacotherapy.
24858991 2013 The frequency of CYP2C9, VKORC1, and CYP4F2 polymorphisms in Russian patients with high thrombotic risk.
24830941 2014 Regulation of human CYP2C9 expression by electrophilic stress involves activator protein 1 activation and DNA looping.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24798722 2014 How common are drug and gene interactions? Prevalence in a sample of 1143 patients with CYP2C9, CYP2C19 and CYP2D6 genotyping.
24797541 2014 Frequency of CYP2C9 and VKORC1 gene polymorphisms and their influence on warfarin dose in Egyptian pediatric patients.
24615047 2014 Effect of CYP2C9*3 mutant variants on meloxicam pharmacokinetics in a healthy Chinese population.
24602049 2014 Association of gene polymorphisms with the risk of warfarin bleeding complications at therapeutic INR in patients with mechanical cardiac valves.
24601977 2014 The impact of age and CYP2C9 and VKORC1 variants on stable warfarin dose in the paediatric population.
24593903 2014 Genetic polymorphisms in warfarin and tacrolimus-related genes VKORC1, CYP2C9 and CYP3A5 in the Greek-Cypriot population.
24530212 2014 Influence of CYP2C9 polymorphism and phenytoin co-administration on acenocoumarol dose in patients with cerebral venous thrombosis.
24528284 2014 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.
24527758 2014 Genetic variations in the xenobiotic-metabolizing enzymes CYP1A1, CYP1A2, CYP2C9, CYP2C19 and susceptibility to colorectal cancer among Turkish people.
24492587 2014 Effect of cytochrome P450 2C19 and 2C9 amino acid residues 72 and 241 on metabolism of tricyclic antidepressant drugs.
24474498 2014 VKORC1 and CYP2C9 genotypes are predictors of warfarin-related outcomes in children.
24464600 2014 CYP2C9*2 allele increases risk for hypoglycemia in POR*1/*1 type 2 diabetic patients treated with sulfonylureas.
24442125 2014 CYP2C9, KCNJ11 and ABCC8 polymorphisms and the response to sulphonylurea treatment in type 2 diabetes patients.
24430292 2014 Genetic polymorphisms of CYP2C8, CYP2C9 and CYP2C19 in Ecuadorian Mestizo and Spaniard populations: a comparative study.
24414392 2014 Association between cytochrome P450 2C9 gene polymorphisms and colorectal cancer susceptibility: evidence from 16 case-control studies.
24403552 2014 Voriconazole metabolism, toxicity, and the effect of cytochrome P450 2C19 genotype.
24399734 2013 Effect of CYP2C9 and VKORC1 genetic variations on warfarin dose requirements in Indian patients.
24340040 2013 Polymorphic cytochrome P450 enzymes (CYPs) and their role in personalized therapy.
24338437 2014 The effect of genetic polymorphisms of cytochrome P450 CYP2C9, CYP2C19, and CYP2D6 on drug-resistant epilepsy in Turkish children.
24337438 2014 A model predicting fluindione dose requirement in elderly inpatients including genotypes, body weight, and amiodarone.
24322170 2014 Strongly increased exposure of meloxicam in CYP2C9*3/*3 individuals.
24288737 2013 Role of xenobiotic metabolism enzyme gene polymorphism in the formation of chemotherapy resistance in patients with chronic lymphoproliferative diseases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24222221 2013 Genetic contribution of CYP2C9, CYP2C19, and APOE variants in acenocoumarol response.
24166101 2014 The use of immobilized cytochrome P4502C9 in PMMA-based plug flow bioreactors for the production of drug metabolites.
24038489 2014 In vivo alterations in drug metabolism and transport pathways in patients with chronic kidney diseases.
24029542 2013 Warfarin pharmacogenetics: a controlled dose-response study in healthy subjects.
24024895 2013 CYP2C9 and ABCG2 polymorphisms as risk factors for developing adverse drug reactions in renal transplant patients taking fluvastatin: a case-control study.
23959274 2014 Interethnic differences in the relevance of CYP2C9 genotype and environmental factors for diclofenac metabolism in Hispanics from Cuba and Spain.
23941071 2013 Association of genetic polymorphisms with warfarin dose requirements in Chinese patients.
23932037 2013 Influence of CYP2C9 and VKORC1 genotypes on the risk of hemorrhagic complications in warfarin-treated patients: a systematic review and meta-analysis.
23930675 2013 Effects of polymorphisms in ABCG2, SLCO1B1, SLC10A1 and CYP2C9/19 on plasma concentrations of rosuvastatin and lipid response in Chinese patients.
23863877 2013 Association of CYP2C9*2 with bosentan-induced liver injury.
23849849 2013 The association between CYP 2C9 polymorphism and bone health.
23844998 2014 Effect of 36 CYP2C9 variants found in the Chinese population on losartan metabolism in vitro.
23834474 2014 Expansion of a PBPK model to predict disposition in pregnant women of drugs cleared via multiple CYP enzymes, including CYP2B6, CYP2C9 and CYP2C19.
23800980 2014 Factors affecting warfarin dose requirements and quality of anticoagulation in adult Egyptian patients: role of gene polymorphism.
23775837 2014 Detection of anti-isoniazid and anti-cytochrome P450 antibodies in patients with isoniazid-induced liver failure.
23774101 2013 The bleeding risk during warfarin therapy is associated with the number of variant alleles of CYP2C9 and VKORC1 genes.
23755828 2013 Genetic variants associated with warfarin dose in African-American individuals: a genome-wide association study.
23752738 2014 Functional characterization of 32 CYP2C9 allelic variants.
23732294 2013 CYP2C9 genotype and association with bone mineral density: a pilot study.
23726967 2013 Resequencing of VKORC1, CYP2C9 and CYP4F2 genes in Italian patients requiring extreme low and high warfarin doses.
23688605 2013 First report of warfarin dose requirements in patients possessing the CYP2C9*12 allele.
23677510 2014 The effect of CYP2C9, VKORC1 and CYP4F2 polymorphism and of clinical factors on warfarin dosage during initiation and long-term treatment after heart valve surgery.
23651023 2013 Impact of CYP2C9 polymorphisms on the vulnerability to pharmacokinetic drug-drug interactions during acenocoumarol treatment.
23615745 2013 Cytochrome P450 2B6 and 2C9 genotype polymorphism--a possible cause of prasugrel low responsiveness.
23586031 2013 Genotyping of CYP2C9 and VKORC1 in the Arabic population of Al-Ahsa, Saudi Arabia.
23582453 2013 Implication of novel CYP2C9*57 (p.Asn204His) variant in coumarin hypersensitivity.
23577132 2013 Quantitative assessment of the effect of cytochrome P450 2C9 gene polymorphism and colorectal cancer.
23563037 2013 Variability in CYP2C9 allele frequency: a pilot study of its predicted impact on warfarin response among healthy South and North Indians.
23556337 2013 CYP2C9*3(1075A > C), ABCB1 and SLCO1B1 genetic polymorphisms and gender are determinants of inter-subject variability in pitavastatin pharmacokinetics.
23481074 2013 Cytochrome P450 (CYP2C9*2,*3) & vitamin-K epoxide reductase complex (VKORC1 -1639G<A) gene polymorphisms & their effect on acenocoumarol dose in patients with mechanical heart valve replacement.
23473641 2013 Effect of CYP2C9 and VKORC1 genetic polymorphisms on mean daily maintenance dose of acenocoumarol in South Indian patients.
23469989 2013 Lack of association between genetic polymorphisms of CYP3A4, CYP2C9 and CYP2C19 and antituberculosis drug-induced liver injury in a community-based Chinese population.
23446815 2013 Genotype-phenotype correlation of cytochrome P450 2C9 polymorphism in Indian National Capital Region.
23376925 2013 CYP2C9 promoter region single-nucleotide polymorphisms linked to the R150H polymorphism are functional suggesting their role in CYP2C9*8-mediated effects.
23358499 2013 Influence of admixture components on CYP2C9*2 allele frequency in eight indigenous populations from Northwest Mexico.
23348161 2013 The relationship between CYP2C9 gene polymorphisms and upper gastrointestinal bleeding in patients who used warfarin.
23279643 2013 The VKORC1 and CYP2C9 genotypes are associated with over-anticoagulation during initiation of warfarin therapy in children.
23201087 2013 Effect of different genetics variants: CYP2C9*2, CYP2C9*3 of cytochrome P-450 CYP2C9 and 1639G>A of the VKORC1 gene; On acenocoumarol requirement in Moroccan patients.
23183958 2013 Genetic and clinical determinants influencing warfarin dosing in children with heart disease.
23171336 2012 Losartan hydroxylation phenotype in an Ecuadorian population: influence of CYP2C9 genetic polymorphism, habits and gender.
23159639 2013 The impact of the CYP2C9 and VKORC1 polymorphisms on acenocoumarol dose requirements in a Romanian population.
23159358 2013 Role of CYP2C9 polymorphism in phenytoin-related metabolic abnormalities and subclinical atherosclerosis in young adult epileptic patients.
23145098 2012 Meta-analysis of cytochrome P-450 2C9 polymorphism and colorectal cancer risk.
23118231 2012 Structural characterization of human cytochrome P450 2C19: active site differences between P450s 2C8, 2C9, and 2C19.
23113310 2012 CYP2C9 and VKORC1 gene polymorphism is inessential for bleeding development under conditions of oral application of anticoagulant acenocoumarol in Russian patients at high risk of thromboembolic complications.
23099353 2012 Effects of UGT1A6, UGT2B7, and CYP2C9 genotypes on plasma concentrations of valproic acid in Chinese children with epilepsy.
23089473 2012 STAT3 & Cytochrome P450 2C9: a novel signaling pathway in liver cancer stem cells.
23081704 2013 The impact of Cytochrome P450 CYP1A2, CYP2C9, CYP2C19 and CYP2D6 genes on suicide attempt and suicide risk-a European multicentre study on treatment-resistant major depressive disorder.
23081681 2013 CYP2C9 variants increase risk of colorectal adenoma recurrence and modify associations with smoking but not aspirin treatment.
23065265 2012 The prevalence of VKORC1 1639 G>A and CYP2C9*2*3 genotypes in patients that requiring anticoagulant therapy in Turkish population.
22952875 2012 Influence of CYP2C9 and VKORC1 on patient response to warfarin: a systematic review and meta-analysis.
22941809 2012 CYP2C9*3(1075A>C), MDR1 G2677T/A and MDR1 C3435T are determinants of inter-subject variability in fluvastatin pharmacokinetics in healthy Chinese volunteers.
22918969 2012 Generation and characterization of novel cytochrome P450 Cyp2c gene cluster knockout and CYP2C9 humanized mouse lines.
22855348 2013 Responsiveness to low-dose warfarin associated with genetic variants of VKORC1, CYP2C9, CYP2C19, and CYP4F2 in an Indonesian population.
22854539 2012 Warfarin pharmacogenetics: development of a dosing algorithm for Omani patients.
22842957 2013 Effect of CYP2C9 and SLCO1B1 polymorphisms on the pharmacokinetics and pharmacodynamics of nateglinide in healthy Chinese male volunteers.
22808915 2012 CYP2C9 and VKORC1 polymorphisms are differently distributed in the Brazilian population according to self-declared ethnicity or genetic ancestry.
22735459 2012 Effects of CYP2C9*1/*3 and *1/*13 on the pharmacokinetics of losartan and its active metabolite E-3174.
22641027 2013 Neurological toxicity after phenytoin infusion in a pediatric patient with epilepsy: influence of CYP2C9, CYP2C19 and ABCB1 genetic polymorphisms.
22589111 2012 Rapid testing of clopidogrel resistance by genotyping of CYP2C19 and CYP2C9 polymorphisms using denaturing on-chip capillary electrophoresis.
22571356 2012 Polymorphisms in VKORC1 have more impact than CYP2C9 polymorphisms on early warfarin International Normalized Ratio control and bleeding rates.
22547083 2012 Effect of P450 oxidoreductase variants on the metabolism of model substrates mediated by CYP2C9.1, CYP2C9.2, and CYP2C9.3.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
22534826 2012 A new algorithm to predict warfarin dose from polymorphisms of CYP4F2 , CYP2C9 and VKORC1 and clinical variables: derivation in Han Chinese patients with non valvular atrial fibrillation.
22533669 2012 Frequency of VKORC1 (C1173T) and CYP2C9 genetic polymorphisms in Egyptians and their influence on warfarin maintenance dose: proposal for a new dosing regimen.
22528326 2012 Impact of CYP2C9*3, VKORC1-1639, CYP4F2rs2108622 genetic polymorphism and clinical factors on warfarin maintenance dose in Han-Chinese patients.
22452429 2012 Warfarin pharmacogenetics: polymorphisms of the CYP2C9, CYP4F2, and VKORC1 loci in a genetically admixed Omani population.
22409277 2012 An evaluation of gene-gene interaction between the CYP2C9 and VKORC1 genotypes affecting the anticoagulant effect of phenprocoumon and acenocoumarol.
22393834 2012 Genetic polymorphisms of VKORC1, CYP2C9, CYP4F2 in Bai, Tibetan Chinese.
22378156 2012 Decreased warfarin clearance associated with the CYP2C9 R150H (*8) polymorphism.
22294058 2012 Search for the molecular basis of ultra-rapid CYP2C9-catalysed metabolism: relationship between SNP IVS8-109A>T and the losartan metabolism phenotype in Swedes.
22290467 2012 Prevalence of CYP2C9 and VKORC1 alleles in the Argentine population and implications for prescribing dosages of anticoagulants.
22289258 2012 CYP2C9 promoter variable number tandem repeat polymorphism regulates mRNA expression in human livers.
22288731 2012 Allele and genotype frequencies of CYP2C9 within an Iranian population (Mazandaran).
22272893 2012 Cytochrome P450 1B1 and 2C9 genotypes and risk of ischemic vascular disease, cancer, and chronic obstructive pulmonary disease.
22252093 2012 Long-term anticoagulant effects of the CYP2C9 and VKORC1 genotypes in acenocoumarol users.
22198820 2012 Integrating interacting drugs and genetic variations to improve the predictability of warfarin maintenance dose in Chinese patients.
22188360 2012 Copy number variation and warfarin dosing: evaluation of CYP2C9, VKORC1, CYP4F2, GGCX and CALU.
22108774 2012 Fluconazole but not the CYP3A4 inhibitor, itraconazole, increases zafirlukast plasma concentrations.
22075505 2011 The effect of CYP2C9, VKORC1 genotypes and old age on warfarin pharmacologic sensitivity in korean patients with thromboembolic disease.
22075408 2013 Differential impact of cytochrome 2C9 allelic variants on clopidogrel-mediated platelet inhibition determined by five different platelet function tests.
22023024 2012 The pharmacogenetics of the response to warfarin in Chinese.
21985811 2011 Possible role of CYP2C9 & CYP2C19 single nucleotide polymorphisms in drug refractory epilepsy.
21977947 2012 Distribution of CYP2C polymorphisms in an Amerindian population of Brazil.
21883387 2012 Impact of genetic factors (VKORC1, CYP2C9, CYP4F2 and EPHX1) on the anticoagulation response to fluindione.
21861665 2011 Novel drug metabolism indices for pharmacogenetic functional status based on combinatory genotyping of CYP2C9, CYP2C19 and CYP2D6 genes.
21852944 2011 Structure and dynamics of the membrane-bound cytochrome P450 2C9.
21798861 2011 Genetic variation in the CYP2C monooxygenase enzyme subfamily shows no association with longevity in a German population.
21786578 2011 [Polymorphisms of genes CYP2C9 and VKORC1 in patients with venous thromboembolic complications in Moscow population: effects on stability of anticoagulant therapy and frequency of hemorrhage].
21768671 Association and treatment response to capecitabine-based chemoradiotherapy with CYP2C9 polymorphism in head and neck cancer.
21766908 2011 Development of cocaine-induced interstitial lung damage in two CYP2C and VKORC1 variant allele carriers.
21757329 2011 Polysaccharide peptides from Coriolus versicolor competitively inhibit tolbutamide 4-hydroxylation in specific human CYP2C9 isoform and pooled human liver microsomes.
21725053 2011 Prospective evaluation of a pharmacogenetics-guided warfarin loading and maintenance dose regimen for initiation of therapy.
21692828 2012 The population pharmacokinetics of R- and S-warfarin: effect of genetic and clinical factors.
21691805 2011 Mild hypoglycaemic attacks induced by sulphonylureas related to CYP2C9, CYP2C19 and CYP2C8 polymorphisms in routine clinical setting.
21651319 2011 Pharmacogenetics of coumarin dosing: prevalence of CYP2C9 and VKORC1 polymorphisms in the Lebanese population.
21639946 2011 Genetic factors associated with patient-specific warfarin dose in ethnic Indonesians.
21638223 2011 Extreme sensitivity to acenocoumarol therapy in patient with both VKORC.-1639 A/A and CYP2C9*1/*3 genotypes.
21605066 2011 Comparison of metabolic soft spot predictions of CYP3A4, CYP2C9 and CYP2D6 substrates using MetaSite and StarDrop.
21597400 2011 Influence of CYP2C9 genetic variants on gastrointestinal bleeding associated with nonsteroidal anti-inflammatory drugs: a systematic critical review.
21576599 2011 Cholesterol 25-hydroxylation activity of CYP3A.
21544933 2011 [CYP2C9 and VKORC1 gene polymorphism and acenocoumarol anticoagulant activity in Russian patients at high risk of thromboembolic complications].
21537551 2011 CYP2C9 polymorphism in patients with epilepsy: genotypic frequency analyzes and phenytoin adverse reactions correlation.
21533175 2011 Eight common genetic variants associated with serum DHEAS levels suggest a key role in ageing mechanisms.
21493749 2011 The ligands of estrogen receptor ? regulate cytochrome P4502C9 (CYP2C9) expression.
21451434 2011 Characterization of a novel CYP2C9 gene mutation and structural bioinformatic protein analysis in a warfarin hypersensitive patient.
21375401 2011 Haplotype structures of common variants of CYP2C8, CYP2C9, and ADRB1 genes in a South Indian population.
21371265 2011 Distribution of the major cytochrome P450 (CYP) 2C9 genetic variants in a Saudi population.
21334530 2011 Genetic substudy of the PLATO trial.
21292004 2011 NCOA6 differentially regulates the expression of the CYP2C9 and CYP3A4 genes.
21248432 2010 Frequencies of VKORC1 -1639 G>A, CYP2C9*2 and CYP2C9*3 genetic variants in the Northern Indian population.
21215088 2010 [Gene polymorphism of CYP450 2C9 and VKORC1 in Chinese population and their relationships to the maintaining dosage of warfarin].
21213107 2011 Impact of clinical factors and CYP2C9 variants for the risk of severe sulfonylurea-induced hypoglycemia.
21173785 2012 Global pharmacogenomics: Impact of population diversity on the distribution of polymorphisms in the CYP2C cluster among Brazilians.
21167292 2011 Esophageal cancer proliferation is mediated by cytochrome P450 2C9 (CYP2C9).
21160360 2011 CYP2C9 variants and blood pressure response to salt: when salt sensitivity meets pharmacogenomics.
21148049 2011 Influence of CYP2C9 and VKORC1 polymorphisms on warfarin and acenocoumarol in a sample of Lebanese people.
21127708 2011 Genetic variation of VKORC1 and CYP4F2 genes related to warfarin maintenance dose in patients with myocardial infarction.
21110192 2011 Contribution of VKORC1 and CYP2C9 polymorphisms in the interethnic variability of warfarin dose in Malaysian populations.
21108610 2010 Analysis of CYP2C9*2, CYP2C19*2, and CYP2D6*4 polymorphisms in patients with type 2 diabetes mellitus.
21071160 2011 Analysis of 50 SNPs in CYP2D6, CYP2C19, CYP2C9, CYP3A4 and CYP1A2 by MALDI-TOF mass spectrometry in Chinese Han population.
21068649 2010 Influence of CYP2C9 genetic polymorphism and undernourishment on plasma-free phenytoin concentrations in epileptic patients.
21063236 2011 Dependency of phenprocoumon dosage on polymorphisms in the VKORC1, CYP2C9, and CYP4F2 genes.
21057703 2011 Impact of pharmacokinetic (CYP2C9) and pharmacodynamic (VKORC1, F7, GGCX, CALU, EPHX1) gene variants on the initiation and maintenance phases of phenprocoumon therapy.
21047199 2010 Impact of CYP2C8 and 2C9 polymorphisms on coronary artery disease and myocardial infarction in the LURIC cohort.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20970553 2010 Toward personalized medicine in renal transplantation.
20962433 2010 Benzbromarone pharmacokinetics and pharmacodynamics in different cytochrome P450 2C9 genotypes.
20946155 2011 Thirteen novel VKORC1 mutations associated with oral anticoagulant resistance: insights into improved patient diagnosis and treatment.
20941486 2011 NAT2, CYP2C9, CYP2C19, and CYP2E1 genetic polymorphisms in anti-TB drug-induced maculopapular eruption.
20937634 2010 Cigarette smoking, genetic variants in carcinogen-metabolizing enzymes, and colorectal cancer risk.
20930419 2010 Pharmacokinetic and pharmacodynamic variation associated with VKORC1 and CYP2C9 polymorphisms in Thai patients taking warfarin.
20885015 Investigation of allele and genotype frequencies of CYP2C9, CYP2C19 and VKORC1 in Iran.
20884456 2010 Impact of CYP2C9 genetic polymorphism on warfarin dose requirements in Pakistani population.
20857895 2010 Prevalence of CYP450 gene variations in patients with type 2 diabetes.
20854800 2011 Genotyping three SNPs affecting warfarin drug response by isothermal real-time HDA assays.
20852447 2011 Role of CYP2C9 genetic variants for salt sensitivity and the regulation of the renin-angiotensin-aldosterone system in normotensive men.
20845310 2010 Genetic polymorphisms of cytochrome P450 enzymes 2C9 and 2C19 in a healthy Mongolian population in China.
20842355 2010 VKORC1-1639G>A, CYP2C9, EPHX1691A>G genotype, body weight, and age are important predictors for warfarin maintenance doses in patients with mechanical heart valve prostheses in southwest China.
20833980 2010 In pediatric patients, age has more impact on dosing of vitamin K antagonists than VKORC1 or CYP2C9 genotypes.
20833683 2010 CYP2C19*2 and CYP2C9*3 alleles are associated with stent thrombosis: a case-control study.
20833655 2010 Genome-wide association study identifies genetic determinants of warfarin responsiveness for Japanese.
20831536 2010 Influence of CYP2C9 and CYP2C19 genetic polymorphisms on pharmacokinetics and pharmacodynamics of gliclazide in healthy Chinese Han volunteers.
20831047 2010 [Anticoagulant action and safety of warfarin dosing based on pharmacogenetic testing: results of the first Russian prospective pilot study].
20815369 2010 Intramolecular heme ligation of the cytochrome P450 2C9 R108H mutant demonstrates pronounced conformational flexibility of the B-C loop region: implications for substrate binding.
20811787 2010 The association of protein S Tokushima-K196E with a risk of deep vein thrombosis.
20808793 2010 Are cytochrome P450 CYP2C8 and CYP2C9 polymorphisms associated with ibuprofen response in very preterm infants?
20733952 2010 Warfarin genotyping using three different platforms.
20722625 2010 Co-expression of recombinant human CYP2C9 with human cytochrome P450 reductase in protease deficient S. cerevisiae strain at a higher scale yields an enzyme of higher specific activity.
20716240 2010 New genetic variant that might improve warfarin dose prediction in African Americans.
20709439 2010 Warfarin dosing in patients with impaired kidney function.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20677151 2010 [Association of polymorphisms of cytochrome P450 2C9 exon 4 and -65G>C with warfarin sensitivity].
20665013 2010 Linkage disequilibrium between the CYP2C19*17 allele and wildtype CYP2C8 and CYP2C9 alleles: identification of CYP2C haplotypes in healthy Nordic populations.
20656072 2011 Flexibility of human cytochrome P450 enzymes: molecular dynamics and spectroscopy reveal important function-related variations.
20653676 2010 CYP4F2 rs2108622: a minor significant genetic factor of warfarin dose in Han Chinese patients with mechanical heart valve replacement.
20653674 2010 A haplotype of CYP2C9 associated with warfarin sensitivity in mechanical heart valve replacement patients.
20637959 2010 The impact of genetic polymorphisms and patient characteristics on warfarin dose requirements: a cross-sectional study in Iran.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20615525 2010 VKORC1 V66M mutation in African Brazilian patients resistant to oral anticoagulant therapy.
20602621 2010 Influence of CYP2C9 polymorphism on metabolism of valproate and its hepatotoxin metabolite in Iranian patients.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20602612 2010 Genetic profile of patients with epilepsy on first-line antiepileptic drugs and potential directions for personalized treatment.
20597268 2010 [Recurrent thromboses and hemorrhagic complications in patients with antiphospholipid syndrome during therapy with warfarin plus aspirin].
20585834 2011 Warfarin dosing algorithm using clinical, demographic and pharmacogenetic data from Chinese patients.
20585445 2010 A novel, single algorithm approach to predict acenocoumarol dose based on CYP2C9 and VKORC1 allele variants.
20569971 2010 Algorithms using clinical and genetic data (CYP2C9, VKORC1) are relevant to predict warfarin dose in patients with different INR targets.
20555338 2010 Worldwide allele frequency distribution of four polymorphisms associated with warfarin dose requirements.
20553802 2010 Application of Akaike information criterion to evaluate warfarin dosing algorithm.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20504253 2010 Combined CYP2C9, VKORC1 and CYP4F2 frequencies among racial and ethnic groups.
20499136 2010 An evaluation of nine genetic variants related to metabolism and mechanism of action of warfarin as applied to stable dose prediction.
20488169 2010 CYP2C9 and VKORC1 genotypes in Puerto Ricans: A case for admixture-matching in clinical pharmacogenetic studies.
20459744 2010 Cyclophosphamide-metabolizing enzyme polymorphisms and survival outcomes after adjuvant chemotherapy for node-positive breast cancer: a retrospective cohort study.
20459419 2010 [Which of algorithms of warfarin dosing based on results of pharmacogenetic testing is suitable for patients in Russia].
20458343 2011 CYP2C9 allele frequency differences between populations of Mexican-Mestizo, Mexican-Tepehuano, and Spaniards.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20445534 2010 CYP2C9*3 Loss-of-Function Allele Is Associated With Acute Upper Gastrointestinal Bleeding Related to the Use of NSAIDs Other Than Aspirin.
20442691 2010 Extending and evaluating a warfarin dosing algorithm that includes CYP4F2 and pooled rare variants of CYP2C9.
20437850 Alcohol, tobacco and genetic susceptibility in relation to cancers of the upper aerodigestive tract in northern Italy.
20436375 2010 Genetic variance in CYP2C8 and increased risk of myocardial infarction.
20434758 2010 VKORC1 and CYP2C9 genetic polymorphisms in hepatic or portal vein thrombosis.
20430047 2010 Biological definition of multiple chemical sensitivity from redox state and cytokine profiling and not from polymorphisms of xenobiotic-metabolizing enzymes.
20421126 2010 A regression model to predict warfarin dose from clinical variables and polymorphisms in CYP2C9, CYP4F2, and VKORC1: Derivation in a sample with predominantly a history of venous thromboembolism.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20390258 2010 Influence of CYP2C9 and CYP2C19 genetic polymorphisms on phenytoin-induced neurological toxicity in Indian epileptic patients.
20386359 2010 Gene-based warfarin dosing compared with standard of care practices in an orthopedic surgery population: a prospective, parallel cohort study.
20381283 2010 Warfarin genotyping reduces hospitalization rates results from the MM-WES (Medco-Mayo Warfarin Effectiveness study).
20376629 2010 VKORC1 -1639G>A and CYP2C9*3 are the major genetic predictors of phenprocoumon dose requirement.
20375999 2010 Integration of genetic, clinical, and INR data to refine warfarin dosing.
20375710 2010 Polymorphisms in xenobiotic metabolizing enzymes and diet influence colorectal adenoma risk.
20373852 2010 Microarray-based detection of CYP1A1, CYP2C9, CYP2C19, CYP2D6, GSTT1, GSTM1, MTHFR, MTRR, NQO1, NAT2, HLA-DQA1, and AB0 allele frequencies in native Russians.
20359257 2010 Development of primer-special TaqMan PCR: a novel SNP detection method to detect CYP2C9 3 in South Chinese.
20354686 2010 Increased frequency of CYP2C9 variant alleles and homozygous VKORC1*2B carriers in warfarin-treated patients with excessive INR response.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20339978 2010 The impact of CYP2C9 and VKORC1 genetic polymorphism and patient characteristics upon warfarin dose requirements in an adult Turkish population.
20339191 2010 Evaluation of pharmacogenetic algorithm for warfarin dose requirements in Japanese patients.
20297661 2010 [Analysis of genetic predisposition to pulmonary tuberculosis in native Russians].
20235787 2010 Common sequence variants in pharmacodynamic and pharmacokinetic pathway-related genes conferring LDL cholesterol response to statins.
20228265 2010 Validation and comparison of pharmacogenetics-based warfarin dosing algorithms for application of pharmacogenetic testing.
20226775 2010 Comparison of assay systems for warfarin-related CYP2C9 and VKORC1 genotyping.
20210733 2010 Distribution of CYP2C9 and VKORC1 risk alleles for warfarin sensitivity and resistance in the Israeli population.
20207952 2010 Hepatic metabolism and transporter gene variants enhance response to rosuvastatin in patients with acute myocardial infarction: the GEOSTAT-1 Study.
20204461 2010 Accuracy assessment of pharmacogenetically predictive warfarin dosing algorithms in patients of an academic medical center anticoagulation clinic.
20179710 2010 Influence of pharmacogenetics on response and toxicity in breast cancer patients treated with doxorubicin and cyclophosphamide.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
20167002 2009 Investigation of the CYP2C9 induction profile in human hepatocytes by combining experimental and modelling approaches.
20150829 2010 Cytochrome P450 2C9-CYP2C9.
20149073 2010 Pharmacogenetics of acenocoumarol in patients with extreme dose requirements.
20147896 2010 A phenotype-genotype approach to predicting CYP450 and P-glycoprotein drug interactions with the mixed inhibitor/inducer tipranavir/ritonavir.
20136364 2010 Errors and reproducibility of DNA array-based detection of allelic variants in ADME genes: PHARMAchip.
20131310 2010 Genetic polymorphisms in cytochrome P450s, GSTs, NATs, alcohol consumption and risk of non-Hodgkin lymphoma.
20121287 2010 Variant VKORC1 and CYP2C9 alleles in patients with diffuse alveolar hemorrhage caused by oral anticoagulants.
20117066 2010 CYP2C9 genotype does not affect risk of tobacco-related cancer in the general population.
20102361 2010 Genotype frequencies of selected drug metabolizing enzymes and ABC drug transporters among breast cancer patients on FAC chemotherapy.
20089352 2010 The influence of cytochrome oxidase CYP2A6, CYP2B6, and CYP2C9 polymorphisms on the plasma concentrations of valproic acid in epileptic patients.
20088379 [Association of xenobiotic-metabolizing gene polymorphisms with childhood atopic diseases in Russian patients from the Republic of Bashkortostan].
20075209 2010 Rapid genotyping of single nucleotide polymorphisms influencing warfarin drug response by surface-enhanced laser desorption and ionization time-of-flight (SELDI-TOF) mass spectrometry.
20073138 2009 Prevalence of combinatorial CYP2C9 and VKORC1 genotypes in Puerto Ricans: implications for warfarin management in Hispanics.
20072124 2010 Genetic and clinical predictors of warfarin dose requirements in African Americans.
20064729 2010 Genetic factors associated with drug-resistance of epilepsy: relevance of stratification by patient age and aetiology of epilepsy.
20043560 2009 Prevalence of CYP2C9 and VKORC1 mutation in patients with valvular heart disease in northern Thailand.
20031551 2008 Pharmacogenetic predictors of statin-mediated low-density lipoprotein cholesterol reduction and dose response.
20029944 2010 Genetic polymorphisms in the metabolic pathway and non-Hodgkin lymphoma survival.
20020283 2010 Genetic determinants of acenocoumarol and phenprocoumon maintenance dose requirements.
19995889 2010 New insights into the regulation of CYP2C9 gene expression: the role of the transcription factor GATA-4.
19958090 2009 Genetic determinants of warfarin dosing in the Han-Chinese population.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19954515 2009 Characterisation of CYP2C8, CYP2C9 and CYP2C19 polymorphisms in a Ghanaian population.
19952982 2010 Maternal EPHX1 polymorphisms and risk of phenytoin-induced congenital malformations.
19942260 2010 Impact of VKORC1 gene polymorphism on interindividual and interethnic warfarin dosage requirement--a systematic review and meta analysis.
19941044 2010 Ethnic differences in the population pharmacokinetics and pharmacodynamics of warfarin.
19935798 2009 CYP2C8 and CYP2C9 polymorphisms in relation to tumour characteristics and early breast cancer related events among 652 breast cancer patients.
19934793 2010 Besides CYP2C19*2, the variant allele CYP2C9*3 is associated with higher on-clopidogrel platelet reactivity in patients on dual antiplatelet therapy undergoing elective coronary stent implantation.
19934028 2010 Gender is an important determinant of the disposition of the loop diuretic torasemide.
19926050 2009 Pharmacogenetic testing for clopidogrel using the rapid INFINITI analyzer: a dose-escalation study.
19925388 2009 Genetic polymorphism of the human cytochrome P450 2C9 gene and its clinical significance.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19903527 2010 Development of swelling/floating gastroretentive drug delivery system based on a combination of hydroxyethyl cellulose and sodium carboxymethyl cellulose for Losartan and its clinical relevance in healthy volunteers with CYP2C9 polymorphism.
19899329 2009 CYP2C9 gene analysis of some Iranian hypersensitive patients to warfarin.
19891554 2009 Presence of CYP2C9*3 allele increases risk for hypoglycemia in Type 2 diabetic patients treated with sulfonylureas.
19891553 2009 Genetic polymorphisms of drug-metabolizing enzymes and anti-TB drug-induced hepatitis.
19881396 2009 Pharmacogenomic trial design: use of a PK/PD model to explore warfarin dosing interventions through clinical trial simulation.
19874474 2010 Ability of VKORC1 and CYP2C9 to predict therapeutic warfarin dose during the initial weeks of therapy.
19847408 2010 The effects of CYP2C9 and CYP2C19 genetic polymorphisms on the pharmacokinetics and pharmacodynamics of glipizide in Chinese subjects.
19833260 2009 The SLCO1B1*5 genetic variant is associated with statin-induced side effects.
19823875 2010 Molecular genetics and epigenetics of the cytochrome P450 gene family and its relevance for cancer risk and treatment.
19822571 2009 Genetic variations in xenobiotic metabolic pathway genes, personal hair dye use, and risk of non-Hodgkin lymphoma.
19794411 2010 Genetic factors (VKORC1, CYP2C9, EPHX1, and CYP4F2) are predictor variables for warfarin response in very elderly, frail inpatients.
19761366 2009 Effects of genetic variation at the CYP2C19/CYP2C9 locus on pharmacokinetics of chlorcycloguanil in adult Gambians.
19745563 2009 VKORC1 diplotype-derived dosing model to explain variability in warfarin dose requirements in Asian patients.
19736056 2009 Associations of common variants in genes involved in metabolism and response to exogenous chemicals with risk of multiple myeloma.
19706858 2009 Association of cytochrome P450 2C19 genotype with the antiplatelet effect and clinical efficacy of clopidogrel therapy.
19696793 2009 Association study of genetic polymorphism in ABCC4 with cyclophosphamide-induced adverse drug reactions in breast cancer patients.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19669737 2009 CYP2C9 genotype and pharmacodynamic responses to losartan in patients with primary and secondary kidney diseases.
19663817 2009 Roles of different CYP enzymes in the formation of specific fluvastatin metabolites by human liver microsomes.
19663669 2009 CYP2C9*8 is prevalent among African-Americans: implications for pharmacogenetic dosing.
19652664 2009 Common polymorphisms in CYP2C9, subclinical atherosclerosis and risk of ischemic vascular disease in 52,000 individuals.
19651758 2009 Hepatic cytochrome P450 enzyme alterations in humans with progressive stages of nonalcoholic fatty liver disease.
19617466 2009 CYP2C9, CYP2C19, and ABCB1 genotype and hospitalization for phenytoin toxicity.
19615687 2009 CYP4A11 polymorphism correlates with coronary endothelial dysfunction in patients with coronary artery disease--the ENCORE Trials.
19605743 2009 Dihydroorotate dehydrogenase polymorphism influences the toxicity of leflunomide treatment in patients with rheumatoid arthritis.
19604036 2009 Effects of the CYP2C9*13 allele on the pharmacokinetics of losartan in healthy male subjects.
19593208 2009 CYP2C9 genotype modifies activity of the renin-angiotensin-aldosterone system in hypertensive men.
19593168 2009 ABCB1 and cytochrome P450 polymorphisms: clinical pharmacogenetics of clozapine.
19593158 2009 Cytochrome P450 CYP1A2, CYP2C9, CYP2C19 and CYP2D6 genes are not associated with response and remission in a sample of depressive patients.
19581657 2009 No modification of the beneficial effect of NSAIDs on colorectal cancer by CYP2C9 genotype.
19578179 2009 A genome-wide association study of acenocoumarol maintenance dosage.
19567378 2010 Pharmacogenetic impact of VKORC1 and CYP2C9 allelic variants on warfarin dose requirements in a hispanic population isolate.
19546880 2009 Influence of ethnicity on pharmacogenetic variation in the Ghanaian population.
19545555 2009 Comparison of performance of three commercial platforms for warfarin sensitivity genotyping.
19541829 2009 Substrate-dependent functional alterations of seven CYP2C9 variants found in Japanese subjects.
19541511 Interethnic differences of CYP2C9 alleles in healthy Hungarian and Roma population samples: relationship to worldwide allelic frequencies.
19538885 2009 [Establishment of a multiplex ligation-dependent SNP genotyping method and its application in the detection of genes related to chemotherapeutic drugs in breast cancer].
19538716 2009 Thrombotic genetic risk factors and warfarin pharmacogenetic variants in São Miguel's healthy population (Azores).
19534586 2009 Membrane integration of recombinant human P450 forms.
19495518 2009 CYP2C9 polymorphism: prevalence in healthy and warfarin-treated Malay and Chinese in Malaysia.
19480553 2009 Pharmacokinetic studies of enantiomers of ibuprofen and its chiral metabolites in humans with different variants of genes coding CYP2C8 and CYP2C9 isoenzymes.
19474452 2009 Perioperative genomic profiles using structure-specific oligonucleotide probes.
19450127 2009 Asthma pharmacogenetic study using finite mixture models to handle drug-response heterogeneity.
19448135 2009 CYP2D6-CYP2C9 protein-protein interactions and isoform-selective effects on substrate binding and catalysis.
19424794 2010 Genetic polymorphisms in phase I and phase II enzymes and breast cancer risk associated with menopausal hormone therapy in postmenopausal women.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19415824 2009 Non-response to antiepileptic pharmacotherapy is associated with the ABCC2 -24C>T polymorphism in young and adult patients with epilepsy.
19415745 2009 Genetic polymorphisms of estrogen metabolizing enzyme and breast cancer risk in Thai women.
19414633 2009 Cytochrome P450 genetic polymorphisms and the response to prasugrel: relationship to pharmacokinetic, pharmacodynamic, and clinical outcomes.
19387626 2009 Exploring warfarin pharmacogenomics with the extreme-discordant-phenotype methodology: impact of FVII polymorphisms on stable anticoagulation with warfarin.
19381164 2009 Prevalence of CYP2C9 polymorphisms in the south of Europe.
19381162 2009 Global variation in CYP2C8-CYP2C9 functional haplotypes.
19369937 2009 Relative impact of genotype and enzyme induction on the metabolic capacity of CYP2C9 in healthy volunteers.
19350405 2009 Population study of genetic polymorphisms and superficial bladder cancer risk in Han-Chinese smokers in Shanghai.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19337788 2009 Frequency of CYP3A4, CYP3A5, CYP2C9, and CYP2C19 variant alleles in patients receiving clopidogrel that experience repeat acute coronary syndrome.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19324988 2009 Validation of clinical testing for warfarin sensitivity: comparison of CYP2C9-VKORC1 genotyping assays and warfarin-dosing algorithms.
19319511 2009 Pharmacogenetic characteristics of patients with complicated phenprocoumon dosing.
19300499 2009 A genome-wide association study confirms VKORC1, CYP2C9, and CYP4F2 as principal genetic determinants of warfarin dose.
19297219 Influence of CYP2C9 and VKORC1 on warfarin response during initiation of therapy.
19290787 2009 Novel DNA sequence variations of cytochrome P450 genes in the Han Chinese population.
19280158 2009 Effect of CYP2C9*3 allele on the pharmacokinetics of naproxen in Korean subjects.
19258521 2009 CYP2C9 amino acid residues influencing phenytoin turnover and metabolite regio- and stereochemistry.
19233910 2009 A multiplex assay for detecting genetic variations in CYP2C9, VKORC1, and GGCX involved in warfarin metabolism.
19233181 2009 Cytochrome P450 2C9 variants influence response to celecoxib for prevention of colorectal adenoma.
19225451 2009 Genotypes associated with reduced activity of VKORC1 and CYP2C9 and their modification of acenocoumarol anticoagulation during the initial treatment period.
19223558 2009 Polymorphic variation in NFKB1 and other aspirin-related genes and risk of Hodgkin lymphoma.
19221727 2009 Effect of silymarin on the pharmacokinetics of losartan and its active metabolite E-3174 in healthy Chinese volunteers.
19219744 2009 Acetaminophen bioactivation by human cytochrome P450 enzymes and animal microsomes.
19207028 2009 CYP4F2 genetic variant (rs2108622) significantly contributes to warfarin dosing variability in the Italian population.
19202563 Regulation of cytochrome P450 2C9 expression in primary cultures of human hepatocytes.
19199010 2009 Covariate-based dose individualization of the cytotoxic drug indisulam to reduce the risk of severe myelosuppression.
19192051 2009 Polymorphic drug metabolizing CYP-enzymes--a pathogenic factor in oral lichen planus?
19181737 2009 Rapid single-nucleotide polymorphism detection of cytochrome P450 (CYP2C9) and vitamin K epoxide reductase (VKORC1) genes for the warfarin dose adjustment by the SMart-amplification process version 2.
19177029 2009 Validation of VKORC1 and CYP2C9 genotypes on interindividual warfarin maintenance dose: a prospective study in Chinese patients.
19164093 2009 Novel variants of major drug-metabolising enzyme genes in diverse African populations and their predicted functional effects.
19151603 2009 Pharmacogenetic variation at CYP2C9, CYP2C19, and CYP2D6 at global and microgeographic scales.
19139476 2009 Pharmacogenomics of warfarin: uncovering a piece of the warfarin mystery.
19136640 2009 Rapid identification of the hepatic cytochrome P450 2C19 activity using a novel and noninvasive [13C]pantoprazole breath test.
19135231 2009 Effect of VKORC1-1639 G>A polymorphism, body weight, age, and serum albumin alterations on warfarin response in Japanese patients.
19117406 2009 SYBR Green-based real-time PCR assay for detection of VKORC1 and CYP2C9 polymorphisms that modulate warfarin dose requirement.
19106084 2009 Cytochrome p-450 polymorphisms and response to clopidogrel.
19099951 2008 [Association between CYP2C9 and VKORC1 genetic polymorphism and warfarin dose requirements].
19082874 2009 Prediction of the effects of genetic polymorphism on the pharmacokinetics of CYP2C9 substrates from in vitro data.
19077919 2009 Effect of CYP2C9 and VKORC1 genotypes on early-phase and steady-state warfarin dosing in Korean patients with mechanical heart valve replacement.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19074728 2009 Relative contribution of CYP2C9 and VKORC1 genotypes and early INR response to the prediction of warfarin sensitivity during initiation of therapy.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19053752 2008 Cytochrome P450 2C9 type II binding studies on quinoline-4-carboxamide analogues.
19031075 2009 Influence of CYP2C9 genotype on warfarin dose requirements--a systematic review and meta-analysis.
19029318 2009 Comprehensive in vitro analysis of voriconazole inhibition of eight cytochrome P450 (CYP) enzymes: major effect on CYPs 2B6, 2C9, 2C19, and 3A.
19026171 2008 Determination of the inhibitory potential of 6 fluoroquinolones on CYP1A2 and CYP2C9 in human liver microsomes.
19018719 2008 VKORC1 and CYP2C9 allelic variants influence acenocoumarol dose requirements in Greek patients.
19010418 2009 CYP2C9 polymorphism in five autochthonous population of the same geographic area (Spanish Pyrenees).
19005461 2009 Interindividual variation in the pharmacokinetics of Delta9-tetrahydrocannabinol as related to genetic polymorphisms in CYP2C9.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18992346 2009 Pharmacogenetic relevance of the CYP2C9*3 allele in a tenoxicam bioequivalence study performed on Spaniards.
18992263 2009 Colon tumor mutations and epigenetic changes associated with genetic polymorphism: insight into disease pathways.
18992148 2008 Low-penetrance alleles predisposing to sporadic colorectal cancers: a French case-controlled genetic association study.
18990750 2008 Red meat intake, doneness, polymorphisms in genes that encode carcinogen-metabolizing enzymes, and colorectal cancer risk.
18971529 2008 Genetic variations of CYP2C9 in 724 Japanese individuals and their impact on the antihypertensive effects of losartan.
18950464 2008 The influence of polymorphisms of VKORC1 and CYP2C9 on major gastrointestinal bleeding risk in anticoagulated patients.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18922023 2008 Functional analysis of phenylalanine residues in the active site of cytochrome P450 2C9.
18855533 2008 VKORC1 polymorphisms, haplotypes and haplotype groups on warfarin dose among African-Americans and European-Americans.
18854779 2008 Relations between polymorphisms in drug-metabolising enzymes and toxicity of chemotherapy with cyclophosphamide, thiotepa and carboplatin.
18836275 2008 The role of CYP2C9 gene polymorphisms on anticoagulant therapy after heart valve replacement.
18816302 2008 Disposition of a CYP2C9 phenotyping agent, losartan, is not influenced by the common 3435C > T variation of the drug transporter gene ABCB1 (MDR1).
18793590 2008 Cytochrome P450 2C9 mediated metabolism in people with and without cancer.
18781852 2008 Effects of CYP2C9 and VKORC1 on INR variations and dose requirements during initial phase of anticoagulant therapy.
18756910 2008 Association of CYP2C9 gene polymorphism with bleeding as a complication of warfarin therapy.
18754597 2008 QM/MM modeling of benzene hydroxylation in human cytochrome P450 2C9.
18754001 2008 Pharmacogenetics of warfarin: development of a dosing algorithm for brazilian patients.
18698879 2008 Pharmacogenetics of oral anticoagulants: a basis for dose individualization.
18694831 2008 Influence of CYP2C8 and CYP2C9 polymorphisms on pharmacokinetic and pharmacodynamic parameters of racemic and enantiomeric forms of ibuprofen in healthy volunteers.
18690342 2008 An analysis of the relative effects of VKORC1 and CYP2C9 variants on anticoagulation related outcomes in warfarin-treated patients.
18681789 2008 Is pharmacogenomics our future? Metformin, ovulation and polymorphism of the STK11 gene in polycystic ovary syndrome.
18680736 2008 Genetic factors contribute to patient-specific warfarin dose for Han Chinese.
18669935 2008 Cytochrome P-450 2C9 signaling does not contribute to age-associated vascular endothelial dysfunction in humans.
18662264 2008 Laboratory and clinical outcomes of pharmacogenetic vs. clinical protocols for warfarin initiation in orthopedic patients.
18629445 2009 Dependency of phenprocoumon dosage on polymorphisms in the VKORC1 and CYP2C9 genes.
18619574 2008 The relative contribution of human cytochrome P450 isoforms to the four caffeine oxidation pathways: an in vitro comparative study with cDNA-expressed P450s including CYP2C isoforms.
18597650 2008 Global pharmacogenetics: genetic substructure of Eurasian populations and its effect on variants of drug-metabolizing enzymes.
18574025 2009 The largest prospective warfarin-treated cohort supports genetic forecasting.
18570163 2008 Role of pharmacodiagnostic of CYP2C9 variants in the optimization of warfarin therapy in Malaysia: a 6-month follow-up study.
18559094 2008 Warfarin dose and INR related to genotypes of CYP2C9 and VKORC1 in patients with myocardial infarction.
18552123 2008 Nuclear receptor coactivator 6 mediates the synergistic activation of human cytochrome P-450 2C9 by the constitutive androstane receptor and hepatic nuclear factor-4alpha.
18548238 2008 Relationship between CYP2C8 genotypes and diclofenac 5-hydroxylation in healthy Spanish volunteers.
18542936 2008 VKORC1 and CYP2C9 polymorphisms are associated with warfarin dose requirements in Turkish patients.
18535201 2008 A genome-wide scan for common genetic variants with a large influence on warfarin maintenance dose.
18516070 2008 Pharmacodynamic interaction of warfarin with cranberry but not with garlic in healthy subjects.
18511451 2008 Important amino acid residues that confer CYP2C19 selective activity to CYP2C9.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18496682 2008 Genetic polymorphism of CYP1A2 and the toxicity of leflunomide treatment in rheumatoid arthritis patients.
18496133 2008 Common variation in cytochrome P450 epoxygenase genes and the risk of incident nonfatal myocardial infarction and ischemic stroke.
18496131 2008 Influence of polymorphisms of drug metabolizing enzymes (CYP2B6, CYP2C9, CYP2C19, CYP3A4, CYP3A5, GSTA1, GSTP1, ALDH1A1 and ALDH3A1) on the pharmacokinetics of cyclophosphamide and 4-hydroxycyclophosphamide.
18485885 2008 Substrate proton to heme distances in CYP2C9 allelic variants and alterations by the heterotropic activator, dapsone.
18480003 2008 Performance of commercial platforms for rapid genotyping of polymorphisms affecting warfarin dose.
18466099 2008 Influence of CYP2C9 and VKORC1 on warfarin dose, anticoagulation attainment and maintenance among European-Americans and African-Americans.
18429757 2008 [Cytochrome P4502C9(CYP2C9) gene polymorphism and safety of therapy with warfarin].
18425152 2008 Allele frequency differences of cytochrome P450 polymorphisms in a sample of New Zealand M?ori.
18419640 2008 CYP2C9 polymorphism in non-steroidal anti-inflammatory drugs-induced gastropathy.
18399713 2008 Determinants of steady-state torasemide pharmacokinetics: impact of pharmacogenetic factors, gender and angiotensin II receptor blockers.
18378563 2008 Differential genotype dependent inhibition of CYP2C9 in humans.
18375260 2008 Prevalence of CYP2C9 variants in the Mexican population.
18370846 2008 Dosing algorithm for warfarin using CYP2C9 and VKORC1 genotyping from a multi-ethnic population: comparison with other equations.
18356043 2008 Identification of the human cytochrome P450 enzymes involved in the in vitro biotransformation of lynestrenol and norethindrone.
18340006 2008 Cytochrome P450 2C9-induced angiogenesis is dependent on EphB4.
18322281 2008 Genetic determinants of response to warfarin during initial anticoagulation.
18315785 2008 Development of a single-tube PCR-pyrosequencing method for the simultaneous and rapid detection of four variant alleles of CYP2C9 gene polymorphism.
18310303 2008 Novel CYP2C9 promoter variants and assessment of their impact on gene expression.
18305455 2008 Use of pharmacogenetic and clinical factors to predict the therapeutic dose of warfarin.
18303964 2008 Impact of genetic polymorphisms in CYP2C8 and rosiglitazone intake on the urinary excretion of dihydroxyeicosatrienoic acids.
18281915 2008 A rapid-ACCE review of CYP2C9 and VKORC1 alleles testing to inform warfarin dosing in adults at elevated risk for thrombotic events to avoid serious bleeding.
18252229 2008 Warfarin pharmacogenetics: CYP2C9 and VKORC1 genotypes predict different sensitivity and resistance frequencies in the Ashkenazi and Sephardi Jewish populations.
18240905 2007 CYP2C9, CYP2C19 and CYP2D6 allele frequencies in the Ashkenazi Jewish population.
18240903 2007 Pharmacogenetically relevant polymorphisms in Portugal.
18231117 2008 Pharmacokinetics/genotype associations for major cytochrome P450 enzymes in native and first- and third-generation Japanese populations: comparison with Korean, Chinese, and Caucasian populations.
18216720 2008 Interaction of CYP2C8 and CYP2C9 genotypes modifies the risk for nonsteroidal anti-inflammatory drugs-related acute gastrointestinal bleeding.
18211048 2008 Novel hierarchical classification and visualization method for multiobjective optimization of drug properties: application to structure-activity relationship analysis of cytochrome P450 metabolism.
18204476 2008 Effects of St John's wort and CYP2C9 genotype on the pharmacokinetics and pharmacodynamics of gliclazide.
18183038 2008 Prospective study of warfarin dosage requirements based on CYP2C9 and VKORC1 genotypes.
18154472 2008 Association of galactose single-point test levels and phenytoin metabolic polymorphisms with gingival hyperplasia in patients receiving long-term phenytoin therapy.
18061941 2008 Polymorphisms in xenobiotic-metabolizing genes and the risk of chronic lymphocytic leukemia and non-Hodgkin's lymphoma in adult Russian patients.
18034619 2007 Allelic variants in the CYP2C9 and VKORC1 loci and interindividual variability in the anticoagulant dose effect of warfarin in Italians.
18034618 2007 Factors influencing warfarin dose requirements in African-Americans.
18030307 2008 Combination of phenotype assessments and CYP2C9-VKORC1 polymorphisms in the determination of warfarin dose requirements in heavily medicated patients.
18024866 2007 Breast cancer treatment outcome with adjuvant tamoxifen relative to patient CYP2D6 and CYP2C19 genotypes.
18021343 2007 Pharmacogenetics of acenocoumarol: CYP2C9, CYP2C19, CYP1A2, CYP3A4, CYP3A5 and ABCB1 gene polymorphisms and dose requirements.
17989110 2007 Randomized trial of genotype-guided versus standard warfarin dosing in patients initiating oral anticoagulation.
17955230 2008 CYP2C9 genotypes and the quality of anticoagulation control with warfarin therapy among Brazilian patients.
17900275 2007 Common polymorphisms of CYP2C19 and CYP2C9 affect the pharmacokinetic and pharmacodynamic response to clopidogrel but not prasugrel.
17899045 2007 Contribution of age, body weight, and CYP2C9 and VKORC1 genotype to the anticoagulant response to warfarin: proposal for a new dosing regimen in Chinese patients.
17895500 2008 Variant CYP2C9 alleles and warfarin concentrations in patients receiving low-dose versus average-dose warfarin therapy.
17868191 2008 Role of CYP2C9 and CYP2C19 polymorphisms in patients with atherosclerosis.
17851566 2008 CYP2C9 genotype-guided warfarin prescribing enhances the efficacy and safety of anticoagulation: a prospective randomized controlled study.
17849045 2007 Current pharmacogenetic developments in oral anticoagulation therapy: the influence of variant VKORC1 and CYP2C9 alleles.
17827526 2006 Identification of CYP2C9*2 allele in HepG2 cell line.
17827141 2007 Hepatotoxicity of oral and intravenous voriconazole in relation to cytochrome P450 polymorphisms.
17764537 2007 Gamma-glutamyl carboxylase (GGCX) tagSNPs have limited utility for predicting warfarin maintenance dose.
17721328 2007 CYP2C9 and VKORC1 genetic polymorphism analysis might be necessary in patients with Factor V Leiden and prothrombin gene G2021A mutation(s).
17686967 2007 Polymorphic variants of CYP2C9: mechanisms involved in reduced catalytic activity.
17681167 2007 Genetic susceptibility to nonsteroidal anti-inflammatory drug-related gastroduodenal bleeding: role of cytochrome P450 2C9 polymorphisms.
17653141 2008 Influence of CYP2C9 and VKORC1 1173C/T genotype on the risk of hemorrhagic complications in African-American and European-American patients on warfarin.
17635185 2007 Increased risk for major depression associated with the short allele of the serotonin transporter promoter region (5-HTTLPR-S) and the CYP2C9*3 allele.
17635181 2007 Genetic polymorphisms of drug-metabolizing enzymes CYP2D6, CYP2C9, CYP2C19 and CYP3A5 in the Greek population.
17635176 2007 Genetic polymorphism of cytochrome P450s and P-glycoprotein in the Finnish population.
17627038 2007 Changes at the CYP2C locus and disruption of CYP2C8/9 linkage disequilibrium in patients with essential tremor.
17627011 2007 Combinations of cytochrome P450 gene polymorphisms enhancing the risk for sporadic colorectal cancer related to red meat consumption.
17603219 2007 Identification and partial characterization of a novel CYP2C9 splicing variant encoding a protein lacking eight amino acid residues.
17597710 2008 Cytochrome P450 2C9 *2 and *3 polymorphisms and the dose and effect of sulfonylurea in type II diabetes mellitus.
17596671 2007 A case report of a patient carrying CYP2C9*3/4 genotype with extremely low warfarin dose requirement.
17596133 2007 The genetic interaction between VKORC1 c1173t and calumenin a29809g modulates the anticoagulant response of acenocoumarol.
17577464 2007 Warfarin metabolism and anticoagulant effect: a prospective, observational study of the impact of CYP2C9 genetic polymorphism in the presence of drug-disease and drug-drug interactions.
17572144 2007 Cytochrome P450 2C9 is involved in flow-dependent vasodilation of peripheral conduit arteries in healthy subjects and in patients with chronic heart failure.
17562299 2007 Contributions of CYP2C9/CYP2C19 genotypes and drug interaction to the phenytoin treatment in the Korean epileptic patients in the clinical setting.
17558303 2007 The risk of myocardial infarction in patients with reduced activity of cytochrome P450 2C9.
17510308 2007 Estimation of warfarin maintenance dose based on VKORC1 (-1639 G>A) and CYP2C9 genotypes.
17504998 2007 CYP2C9 and CYP2C19 polymorphic forms are related to increased indisulam exposure and higher risk of severe hematologic toxicity.
17479200 2007 Any effect of CYP2C9 variants on warfarin clearance in Chinese patients?
17460547 2007 Pharmacogenetics of the 5-lipoxygenase biosynthetic pathway and variable clinical response to montelukast.
17446262 2007 CYP2C9 protein interactions with cytochrome b(5): effects on the coupling of catalysis.
17419358 2007 [The influence of CYP2C9 genetic polymorphism on the pharmacokinetics and pharmacodynamics of warfarin in patients with constant atrial fibrillation].
17418993 2007 Development and full validation of six inhibition assays for five major cytochrome P450 enzymes in human liver microsomes using an automated 96-well microplate incubation format and LC-MS/MS analysis.
17413769 2007 Plasma S/R ratio of warfarin co-varies with VKORC1 haplotype.
17397249 2007 The influence of NSAIDs on coumarin sensitivity in patients with CYP2C9 polymorphism after total hip replacement surgery.
17391071 2007 Factors affecting the interindividual variability of warfarin dose requirement in adult Korean patients.
17368604 2007 The association of CYP2C9 gene polymorphisms with colorectal carcinoma in Han Chinese.
17332144 2007 Characterization of the novel defective CYP2C9*24 allele.
17329986 2007 Interethnic differences in drug response: the contribution of genetic variability in beta adrenergic receptor and cytochrome P4502C9.
17325732 2008 Apolipoprotein E genotype and warfarin dosing among Caucasians and African Americans.
17324110 2007 Warfarin and cytochrome P450 2C9 genotype: possible ethnic variation in warfarin sensitivity.
17304159 2007 Population estimation of the effects of cytochrome P450 2C9 and 2C19 polymorphisms on phenobarbital clearance in Japanese.
17301738 2007 A PK-PD model for predicting the impact of age, CYP2C9, and VKORC1 genotype on individualization of warfarin therapy.
17298483 2007 Influence of CYP2C9 and CYP2C19 genetic polymorphisms on pharmacokinetics of gliclazide MR in Chinese subjects.
17279092 2007 Genetic polymorphisms of CYP2C9 and CYP2C19 are not related to drug-induced idiosyncratic liver injury (DILI).
17269966 2007 Cytochrome P450 polymorphisms in patients with Behcet's disease.
17226852 2008 Oral anticoagulation with warfarin is significantly influenced by steroids and CYP2C9 polymorphisms in children with cancer.
17201743 Genetic polymorphisms of cytochrome P450 enzymes 2C9 and 2C19 in a healthy Iranian population.
17192772 2007 VKORC1 and CYP2C9 genotypes and phenprocoumon anticoagulation status: interaction between both genotypes affects dose requirement.
17178267 2006 ABCB1 and cytochrome P450 genotypes and phenotypes: influence on methadone plasma levels and response to treatment.
17167248 2007 Frequency of CYP2C9 genotypes among Omani patients receiving warfarin and its correlation with warfarin dose.
17157122 2006 Allele variants of the cytochrome P450 2C9 genotype in white subjects from The Netherlands with serious gastroduodenal ulcers attributable to the use of NSAIDs.
17111199 2006 Genotypes of the cytochrome p450 isoform, CYP2C9, and the vitamin K epoxide reductase complex subunit 1 conjointly determine stable warfarin dose: a prospective study.
17110455 2007 A coding VKORC1 Asp36Tyr polymorphism predisposes to warfarin resistance.
17085674 2006 Genetic variants of UGT1A6 influence risk of colorectal adenoma recurrence.
17049586 2007 Genotypes of vitamin K epoxide reductase, gamma-glutamyl carboxylase, and cytochrome P450 2C9 as determinants of daily warfarin dose in Japanese patients.
17048007 2007 Association of warfarin dose with genes involved in its action and metabolism.
17015052 2006 A warfarin-dosing model in Asians that uses single-nucleotide polymorphisms in vitamin K epoxide reductase complex and cytochrome P450 2C9.
16985032 2006 Use of analgesics and nonsteroidal anti-inflammatory drugs, genetic predisposition, and bladder cancer risk in Spain.
16985026 2006 Metabolic gene variants and risk of non-Hodgkin's lymphoma.
16969365 2007 Genetic variation at the CYP2C locus and its association with torsemide biotransformation.
16957870 2006 Distribution of soluble epoxide hydrolase, cytochrome P450 2C8, 2C9 and 2J2 in human malignant neoplasms.
16924387 2006 The high prevalence of the poor and ultrarapid metabolite alleles of CYP2D6, CYP2C9, CYP2C19, CYP3A4, and CYP3A5 in Taiwanese population.
16890578 2006 VKORC1 gene variations are the major contributors of variation in warfarin dose in Japanese patients.
16882880 2006 Transcriptional activation of CYP2C9, CYP1A1, and CYP1A2 by hepatocyte nuclear factor 4alpha requires coactivators peroxisomal proliferator activated receptor-gamma coactivator 1alpha and steroid receptor coactivator 1.
16878445 2006 [Pharmacogenetics and interindividual variability in drug response: cytochrome P-450 2C9 and coumarin anticoagulants].
16873909 2006 Influence of the CYP2C9 AND CYP2C19 polymorphisms on phenytoin hydroxylation in healthy individuals from south India.
16863464 2006 Contribution of CYP2C9 to variability in vitamin K antagonist metabolism.
16847664 2006 Obesity is associated with a slower response to initial phenprocoumon therapy whereas CYP2C9 genotypes are not.
16847429 2006 APOE genotype makes a small contribution to warfarin dose requirements.
16815313 2006 VKORC1 and CYP2C9 genotypes and acenocoumarol anticoagulation status: interaction between both genotypes affects overanticoagulation.
16797247 2006 Interactions between CYP2C9 and UGT1A6 polymorphisms and nonsteroidal anti-inflammatory drugs in colorectal cancer prevention.
16784736 2006 Role of BCRP 421C>A polymorphism on rosuvastatin pharmacokinetics in healthy Chinese males.
16771603 2006 Pharmacogenetic screening for polymorphisms in drug-metabolizing enzymes and drug transporters in a Dutch population.
16749864 Activation of human CYP2C9 promoter and regulation by CAR and PXR in mouse liver.
16740353 2006 On the human CYP2C9*13 variant activity reduction: a molecular dynamics simulation and docking study.
16708125 2006 Pharmacogenomic effect of cytochrome P450 2C9 polymorphisms in different populations.
16699986 2006 Cytochrome P450 2C9 polymorphism and acenocoumarol therapy.
16676068 2006 The influence of sequence variations in factor VII, gamma-glutamyl carboxylase and vitamin K epoxide reductase complex genes on warfarin dose requirement.
16646575 2006 Interethnic and intraethnic variability of CYP2C8 and CYP2C9 polymorphisms in healthy individuals.
16639745 2006 Multiple molecular dynamics simulations of human p450 monooxygenase CYP2C9: the molecular basis of substrate binding and regioselectivity toward warfarin.
16638864 2006 Association of DNA repair and steroid metabolism gene polymorphisms with clinical late toxicity in patients treated with conformal radiotherapy for prostate cancer.
16635054 2006 Malaysian Indians are genetically similar to Caucasians: CYP2C9 polymorphism.
16630605 2006 Frequency of CYP2C9 polymorphisms affecting warfarin metabolism in a large anticoagulant clinic cohort.
16627267 2006 Detection and identification of cytochrome P-450 2C9 alleles *1, *2, and *3 by high-resolution melting curve analysis of PCR amplicons.
16611750 2006 Polymorphisms in the VKORC1 gene are strongly associated with warfarin dosage requirements in patients receiving anticoagulation.
16595916 2006 Multiple regression analysis of pharmacogenetic variability of carvedilol disposition in 54 healthy Japanese volunteers.
16580898 2006 Influence of coagulation factor, vitamin K epoxide reductase complex subunit 1, and cytochrome P450 2C9 gene polymorphisms on warfarin dose requirements.
16552506 2006 The influence of co-treatment with carbamazepine, amiodarone and statins on warfarin metabolism and maintenance dose.
16541193 CYP2C9 Ile359Leu polymorphism, plasma irbesartan concentration and acute blood pressure reductions in response to irbesartan treatment in Chinese hypertensive patients.
16538176 2006 Genetic susceptibility to carbamazepine-induced cutaneous adverse drug reactions.
16432637 2006 Association of VKORC1 and CYP2C9 polymorphisms with warfarin dose requirements in Japanese patients.
16424822 2006 Different contributions of polymorphisms in VKORC1 and CYP2C9 to intra- and inter-population differences in maintenance dose of warfarin in Japanese, Caucasians and African-Americans.
16413010 2006 CYP2C9 polymorphism and warfarin sensitivity in Taiwan Chinese.
16401082 2006 Radical intermediates in the catalytic oxidation of hydrocarbons by bacterial and human cytochrome P450 enzymes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16372821 2005 Effect of genetic polymorphisms in cytochrome p450 (CYP) 2C9 and CYP2C8 on the pharmacokinetics of oral antidiabetic drugs: clinical relevance.
16342679 2005 [Impact of cytochrome P450 CYP2C9 variant allele CYP2C9 * 3 on the pharmacokinetics of glibenclamide and lornoxicam in Chinese subjects].
16338275 2005 Methadone enantiomer plasma levels, CYP2B6, CYP2C19, and CYP2C9 genotypes, and response to treatment.
16325295 2006 Effect of CYP2C9 genetic polymorphisms on the efficacy and pharmacokinetics of glimepiride in subjects with type 2 diabetes.
16321620 2005 Several-fold increase in risk of overanticoagulation by CYP2C9 mutations.
16305587 2005 Gender specific association of CYP2C9*3 with hyperlipidaemia in Chinese.
16305586 2005 Polymorphisms in genes encoding acetylsalicylic acid metabolizing enzymes are unrelated to upper gastrointestinal health in cardiovascular patients on acetylsalicylic acid.
16303885 2005 Impact of age, CYP2C9 genotype and concomitant medication on the rate of rise for prothrombin time during the first 30 days of warfarin therapy.
16297214 2005 Association analysis of drug metabolizing enzyme gene polymorphisms in AIDS patients with cutaneous reactions to sulfonamides.
16268502 2005 [Influence of cytochrom P450 CYP2C9 polymorphism on the pharmacokinetics of tolbutamide metabolism using oligonucleotide genotyping microarray].
16253141 2005 Distribution of cytochrome P450 2C, 2E1, 3A4, and 3A5 in human colon mucosa.
16236141 2005 Influence of CYP2C9, 2C19 and 2D6 genetic polymorphisms on the steady-state plasma concentrations of the enantiomers of fluoxetine and norfluoxetine.
16232205 2005 Phase I pharmacokinetic and pharmacogenomic study of E7070 administered once every 21 days.
16220110 2005 CYP2C9, CYP2C19, ABCB1 (MDR1) genetic polymorphisms and phenytoin metabolism in a Black Beninese population.
16202848 2005 The Prevalence of CYP2C8, 2C9, 2J2, and soluble epoxide hydrolase polymorphisms in African Americans with hypertension.
16198656 2005 CYP2C9, but not CYP2C19, polymorphisms affect the pharmacokinetics and pharmacodynamics of glyburide in Chinese subjects.
16198655 2005 Influence of CYP2C9 genotypes on the pharmacokinetics and pharmacodynamics of piroxicam.
16187974 2005 Allele and genotype frequencies of CYP2C9 in a Korean population.
16183265 2006 Pharmacogenetics of cyclophosphamide in patients with hematological malignancies.
16160068 2005 A prospective, randomized pilot trial of model-based warfarin dose initiation using CYP2C9 genotype and clinical data.
16141797 2005 No evidence that polymorphisms in CYP2C8, CYP2C9, UGT1A6, PPARdelta and PPARgamma act as modifiers of the protective effect of regular NSAID use on the risk of colorectal carcinoma.
16141794 2005 Association of Vitamin K epoxide reductase complex 1 (VKORC1) variants with warfarin dose in a Hong Kong Chinese patient population.
16116487 2005 Association of cyclophosphamide pharmacokinetics to polymorphic cytochrome P450 2C19.
16111713 2005 Ethnic differences in CYP2C9*2 (Arg144Cys) and CYP2C9*3 (Ile359Leu) genotypes in Japanese and Israeli populations.
16099926 2005 Functional characterization of novel allelic variants of CYP2C9 recently discovered in southeast Asians.
16094537 2005 CYP2C9*3 allelic variant is associated with metabolism of irbesartan in Chinese population.
16082538 2005 Simultaneous genotyping of CYP2C9*2, *3, and 5' flanking region (C-1189T) polymorphisms in a Spanish population through a new minisequencing multiplex single-base extension analysis.
16025294 2005 Polymorphism of CYP2D6, CYP2C19, CYP2C9 and CYP2C8 in the Faroese population.
16006997 2005 A comprehensive analysis of phase I and phase II metabolism gene polymorphisms and risk of colorectal cancer.
15970795 2005 In-vitro and in-vivo effects of the CYP2C9*11 polymorphism on warfarin metabolism and dose.
15963101 2005 Association between CYP2C9 slow metabolizer genotypes and severe hypoglycaemia on medication with sulphonylurea hypoglycaemic agents.
15961979 2005 Allelic variants of cytochrome P450 2C9 modify the interaction between nonsteroidal anti-inflammatory drugs and coumarin anticoagulants.
15947090 2005 The impact of CYP2C9 and VKORC1 genetic polymorphism and patient characteristics upon warfarin dose requirements: proposal for a new dosing regimen.
15940194 2005 [Clinical value of allele variants of cytochrome CYP2C9 gene for anticoagulation therapy with warfarin].
15924351 2005 Epoxide hydrolase and CYP2C9 polymorphisms, cigarette smoking, and risk of colorectal carcinoma in the Nurses' Health Study and the Physicians' Health Study.
15919766 2005 The nuclear receptors constitutive androstane receptor and pregnane X receptor cross-talk with hepatic nuclear factor 4alpha to synergistically activate the human CYP2C9 promoter.
15900282 2005 Common genetic variants of microsomal epoxide hydrolase affect warfarin dose requirements beyond the effect of cytochrome P450 2C9.
15900281 2005 CYP2C9 haplotype structure in European American warfarin patients and association with clinical outcomes.
15896241 2005 Relationship of P450 2C9 genetic polymorphisms in Chinese and the pharmacokinetics of tolbutamide.
15889670 2005 [Significance of cytochrome P450 2C9 genotype for the bleeding complications in patients treated with acenocoumarol].
15888487 2005 A novel functional VKORC1 promoter polymorphism is associated with inter-individual and inter-ethnic differences in warfarin sensitivity.
15855721 2005 Evaluation of phenytoin dosage regimens based on genotyping of CYP2C subfamily in routinely treated Japanese patients.
15842554 2005 Chlorpropamide 2-hydroxylation is catalysed by CYP2C9 and CYP2C19 in vitro: chlorpropamide disposition is influenced by CYP2C9, but not by CYP2C19 genetic polymorphism.
15841315 2005 Prospective dosing of warfarin based on cytochrome P-450 2C9 genotype.
15824753 2005 Influence of CYP2C9 polymorphisms, demographic factors and concomitant drug therapy on warfarin metabolism and maintenance dose.
15813658 2005 Cytochrome p450 polymorphisms in geriatric patients: impact on adverse drug reactions--a pilot study.
15795654 2005 Genetic polymorphism of CYP2C9 in a Vietnamese Kinh population.
15790782 2005 Cytochrome P450 2C9 (CYP2C9) and vitamin K epoxide reductase (VKORC1) genotypes as determinants of acenocoumarol sensitivity.
15776277 2005 Genetic polymorphism of CYP2C9 and CYP2C19 in a Bolivian population: an investigative and comparative study.
15742978 2004 Genetic polymorphisms of cytochrome P450 2C9 causing reduced phenprocoumon (S)-7-hydroxylation in vitro and in vivo.
15714076 2005 CYP2C9 gene variants, drug dose, and bleeding risk in warfarin-treated patients: a HuGEnet systematic review and meta-analysis.
15691505 2005 High-throughput detection of multiple genetic polymorphisms influencing drug metabolism with mismatch primers in allele-specific polymerase chain reaction.
15660966 2005 CYP2C9 and CYP2C19 genetic polymorphisms: frequencies in the south Indian population.
15632378 2005 CYP2D6 genotype, antidepressant use, and tamoxifen metabolism during adjuvant breast cancer treatment.
15617742 2005 The frequency of cytochrome P450 2C9 genetic variants in the Russian population and their associations with individual sensitivity to warfarin therapy.
15608560 2004 Upstream and coding region CYP2C9 polymorphisms: correlation with warfarin dose and metabolism.
15606441 2005 The effect of the cytochrome P450 CYP2C8 polymorphism on the disposition of (R)-ibuprofen enantiomer in healthy subjects.
15606435 2005 Lornoxicam pharmacokinetics in relation to cytochrome P450 2C9 genotype.
15592327 2004 CYP2C9 polymorphisms and the interindividual variability in pharmacokinetics and pharmacodynamics of the loop diuretic drug torsemide.
15588114 2004 Linking pharmacovigilance with pharmacogenetics.
15569819 2005 Cytochrome P4502C9-derived epoxyeicosatrienoic acids induce the expression of cyclooxygenase-2 in endothelial cells.
15569425 2004 [Association between genetic polymorphisms of CYP2C19 and CYP2C9 and phenytoin serum concentration].
15536456 2004 Effects of cytochrome P450 2C9 polymorphisms on phenprocoumon anticoagulation status.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469410 2004 Genetic variation in eleven phase I drug metabolism genes in an ethnically diverse population.
15452553 2004 Lower frequency of CYP2C9*2 in Mexican-Americans compared to Spaniards.
15385837 2004 Dosage recommendation of phenytoin for patients with epilepsy with different CYP2C9/CYP2C19 polymorphisms.
15371982 2004 Novel CYP2C9 genetic variants in Asian subjects and their influence on maintenance warfarin dose.
15370961 2004 Stereoselective glucuronidation and hydroxylation of etodolac by UGT1A9 and CYP2C9 in man.
15369736 2004 CYP2C9 allele variants in Chinese hypertension patients and healthy controls.
15290664 2004 A prospective study of genetic polymorphisms in the cytochrome P-450 2C9 enzyme and the risk for distal colorectal adenoma.
15289788 2004 Functional impact of CYP2C95, CYP2C96, CYP2C98, and CYP2C911 in vivo among black Africans.
15284536 2004 Relative impact of covariates in prescribing warfarin according to CYP2C9 genotype.
15284535 2004 Discovery of new potentially defective alleles of human CYP2C9.
15260906 2004 QTc interval, CYP2D6 and CYP2C9 genotypes and risperidone plasma concentrations.
15248218 2004 Cytochrome P450 pharmacogenetics as a predictor of toxicity and clinical response to pulse cyclophosphamide in lupus nephritis.
15229460 2004 CYP2C9 genotypes and the pharmacokinetics of tenoxicam in Brazilians.
15226678 2004 Identification of a novel variant CYP2C9 allele in Chinese.
15222661 2004 Comparison of cytochrome P450 2C9 genotyping methods and implications for the clinical laboratory.
15213846 2004 The risk of bleeding complications in patients with cytochrome P450 CYP2C9*2 or CYP2C9*3 alleles on acenocoumarol or phenprocoumon.
15199455 2003 Genetic regulation of warfarin metabolism and response.
15197523 2004 CYP2C9 genetic variants and losartan oxidation in a Turkish population.
15177309 2004 Allele and genotype frequencies of CYP2C9, CYP2C19 and CYP2D6 in an Italian population.
15175798 2004 Warfarin dosing and cytochrome P450 2C9 polymorphisms.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15145963 2004 Limited sampling strategy of S-warfarin concentrations, but not warfarin S/R ratios, accurately predicts S-warfarin AUC during baseline and inhibition in CYP2C9 extensive metabolizers.
15128048 2004 The risk of overanticoagulation in patients with cytochrome P450 CYP2C9*2 or CYP2C9*3 alleles on acenocoumarol or phenprocoumon.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15116053 2004 Pharmacogenetics of acenocoumarol pharmacodynamics.
15116052 2004 Acenocoumarol stabilization is delayed in CYP2C93 carriers.
15102864 2004 Genetic polymorphisms of cytochrome P450 enzymes and the effect on interindividual, pharmacokinetic variability in extensive metabolizers.
15100169 2004 The impact of CYP2C9 genetics and oral contraceptives on cytochrome P450 2C9 phenotype.