Property Summary

NCBI Gene PubMed Count 142
Grant Count 215
R01 Count 107
Funding $26,361,211.9
PubMed Score 785.16
PubTator Score 472.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
COPD -2.300 0.002
non-small cell lung cancer -3.908 0.000
lung cancer -2.200 0.002
diabetes mellitus 1.100 0.002
lung adenocarcinoma -4.671 0.000
nasopharyngeal carcinoma -3.400 0.000
lung carcinoma -4.600 0.000
chronic rhinosinusitis -3.843 0.003
cystic fibrosis and chronic rhinosinusit... -2.607 0.003
psoriasis -1.600 0.000

Synonym

Accession P11684 B2R5F2 Q6FHH3 Q9UCM2 Q9UCM4
Symbols UGB
UP1
CC10
CC16
CCSP
UP-1
CCPBP

Gene

PANTHER Protein Class (2)

Gene RIF (131)

PMID Text
26914709 Lung-specific (CC-16) and novel (RelB) biomarkers are associated with systemic cardiovascular changes over time. CC-16 can predict subsequent exacerbations in subjects with severe COPD and may be an important biomarker of pulmonary and systemic stress in COPD.
26108072 lower levels of urine CC16 and lung function in patients with asthma than in those patients without asthma. CC16 in urine may be a useful tool or biomarker for investigating lung epithelium integrity among children with asthma or lung injury.
25851191 In chromium-exposed workers, blood levels of CC16, and CC16/SP-D were lower than in controls. Positive relationships were shown between CC16 or CC16/SP-D and indicators of lung function.
25743006 A meta-analysis indicated that the CC16 gene A38G polymorphism is not associated with the risk of asthma.
25728058 Sputum and bronchoalveolar lavage fluid CC16 were significantly higher in patients with severe asthma compared to mild-moderate asthma and healthy controls.
25700379 Smokers and COPD patients had reduced airway CC16 immunostaining that decreased with increasing COPD severity.
25635997 CC16 may play an important protective role in cigarette smoke-related diseases.
25631862 KL-6 levels were higher and CC16 levels were lower in infants with poor neurodevelopmental outcome compared with those infants who had favourable neurodevelopmental outcome.
25244495 The serum concentration of CC16 was significantly higher in patients with lung fibrosis.
25068828 the uteroglobin G38A gene polymorphism was not associated with IgAN risk
More...

AA Sequence

MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLP      1 - 70
QKPRESIIKLMEKIAQSSLCN                                                      71 - 91
//

Text Mined References (144)

PMID Year Title
26914709 2016 Club Cell-16 and RelB as Novel Determinants of Arterial Stiffness in Exacerbating COPD Patients.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26108072 Association of urine CC16 and lung function and asthma in Chinese children.
25851191 2015 Biomarkers for lung epithelium injury in occupational hexavalent chromium-exposed workers.
25743006 2015 CC16 gene A38G polymorphism and susceptibility to asthma: an updated meta-analysis.
25728058 2015 Sputum and BAL Clara cell secretory protein and surfactant protein D levels in asthma.
25700379 2015 Protective role for club cell secretory protein-16 (CC16) in the development of COPD.
25635997 2015 Repression of CC16 by cigarette smoke (CS) exposure.
25631862 2015 Correlation of serum KL-6 and CC16 levels with neurodevelopmental outcome in premature infants at 12 months corrected age.
25416956 2014 A proteome-scale map of the human interactome network.
More...