Property Summary

NCBI Gene PubMed Count 31
Grant Count 90
R01 Count 53
Funding $13,707,958.59
PubMed Score 524.62
PubTator Score 345.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -4.767 0.000

Synonym

Accession P11678 Q4TVP3 EPO
Symbols EPO
EPP
EPXD
EPX-PEN

Gene

EPX

PANTHER Protein Class (2)

Gene RIF (20)

PMID Text
26386352 Myeloperoxidase and eosinophil peroxidase are readily internalized by HUVEC cells where they promote cellular proliferation, migration, invasion, and stimulate angiogenesis both in vitro and in vivo.
24937179 A preferential role of EPO signaling via a specific surface receptor that leads to neural plasticity.
24814827 mRNA levels of eosinophil granule proteins, rather than sputum eosinophil%, may reflect airway hyperresponsiveness and airflow limitation.
24738159 report the prevalence of a common SNP in the eosinophil protein x/eosinophil-derived neurotoxin (EPX/EDN, RNase2) and the association with the cellular contents of EPX/EDN and ECP
23931643 Eosinophil peroxidase in sputum represents a unique biomarker of airway eosinophilia.
23197886 Polymorphisms of EPX and ECP are associated to inflammatory bowel disease in an age and gender dependent manne.
22750539 Data indicate that eosinophil peroxidase (EPX)-based ELISA is the only eosinophil-specific assay.
22702502 A mechanism of induction of ASIC-3 expression relevant to AR was suggested by the finding that eosinophil peroxidase (EPO), acting via ERK1/2, induced the expression of ASIC-3 in epithelial cells.
21454806 HER2 was identified as a novel mediator of eosinophil peroxidase signaling. Eosinophil peroxidase, at noncytotoxic levels, can drive cell-cycle progression and proliferation.
20501663 EPO-dependent oxidative damage may play a role in tissue injury in bisulfite-exacerbated eosinophilic inflammatory disorders
More...

AA Sequence

MHLLPALAGVLATLVLAQPCEGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKSIKQRLRSGSASPM      1 - 70
DLLSYFKQPVAATRTVVRAADYMHVALGLLEEKLQPQRSGPFNVTDVLTEPQLRLLSQASGCALRDQAER     71 - 140
CSDKYRTITGRCNNKRRPLLGASNQALARWLPAEYEDGLSLPFGWTPSRRRNGFLLPLVRAVSNQIVRFP    141 - 210
NERLTSDRGRALMFMQWGQFIDHDLDFSPESPARVAFTAGVDCERTCAQLPPCFPIKIPPNDPRIKNQRD    211 - 280
CIPFFRSAPSCPQNKNRVRNQINALTSFVDASMVYGSEVSLSLRLRNRTNYLGLLAINQRFQDNGRALLP    281 - 350
FDNLHDDPCLLTNRSARIPCFLAGDTRSTETPKLAAMHTLFMREHNRLATELRRLNPRWNGDKLYNEARK    351 - 420
IMGAMVQIITYRDFLPLVLGKARARRTLGHYRGYCSNVDPRVANVFTLAFRFGHTMLQPFMFRLDSQYRA    421 - 490
SAPNSHVPLSSAFFASWRIVYEGGIDPILRGLMATPAKLNRQDAMLVDELRDRLFRQVRRIGLDLAALNM    491 - 560
QRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLYGTPDNIDIWIGAIAEPLLPGARVG    561 - 630
PLLACLFENQFRRARDGDRFWWQKRGVFTKRQRKALSRISLSRIICDNTGITTVSRDIFRANIYPRGFVN    631 - 700
CSRIPRLNLSAWRGT                                                           701 - 715
//

Text Mined References (31)

PMID Year Title
26386352 2015 Uncovering a new role for peroxidase enzymes as drivers of angiogenesis.
24937179 2014 Eosinophil peroxidase induces expression of cholinergic genes via cell surface neural interactions.
24814827 2014 Expression levels of eosinophil granule protein mRNAs in induced sputum reflect airway hyperresponsiveness and airflow limitation.
24738159 2014 The production of the eosinophil proteins ECP and EPX/EDN are regulated in a reciprocal manner.
23931643 2013 Eosinophil peroxidase in sputum represents a unique biomarker of airway eosinophilia.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23197886 2012 Eosinophil associated genes in the inflammatory bowel disease 4 region: correlation to inflammatory bowel disease revealed.
22750539 2012 A sensitive high throughput ELISA for human eosinophil peroxidase: a specific assay to quantify eosinophil degranulation from patient-derived sources.
22702502 2012 Eosinophil peroxidase induces the expression and function of acid-sensing ion channel-3 in allergic rhinitis: in vitro evidence in cultured epithelial cells.
21454806 2011 Eosinophil peroxidase signals via epidermal growth factor-2 to induce cell proliferation.
More...