Property Summary

NCBI Gene PubMed Count 147
PubMed Score 90.55
PubTator Score 102.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ductal carcinoma in situ -1.200 9.2e-05
lung cancer 2.000 5.4e-04
ovarian cancer 1.300 1.5e-04
pancreatic ductal adenocarcinoma liver m... -1.379 2.0e-02
tuberculosis 1.900 1.5e-07
Waldenstrons macroglobulinemia 1.295 2.8e-03

Gene RIF (138)

AA Sequence

MAPAEILNGKEISAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKLKAAEEIGIKATHI      1 - 70
KLPRTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKDVDGLTSINAGRLARGDL     71 - 140
NDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGD    141 - 210
ILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDDKKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTV    211 - 280
AMLMQSTVESAKRFLEKFKPGKWMIQYNNLNLKTPVPSDIDISRSCKPKPIGKLAREIGLLSEEVELYGE    281 - 350
TKAKVLLSALERLKHRPDGKYVVVTGITPTPLGEGKSTTTIGLVQALGAHLYQNVFACVRQPSQGPTFGI    351 - 420
KGGAAGGGYSQVIPMEEFNLHLTGDIHAITAANNLVAAAIDARIFHELTQTDKALFNRLVPSVNGVRRFS    421 - 490
DIQIRRLKRLGIEKTDPTTLTDEEINRFARLDIDPETITWQRVLDTNDRFLRKITIGQAPTEKGHTRTAQ    491 - 560
FDISVASEIMAVLALTTSLEDMRERLGKMVVASSKKGEPVSAEDLGVSGALTVLMKDAIKPNLMQTLEGT    561 - 630
PVFVHAGPFANIAHGNSSIIADRIALKLVGPEGFVVTEAGFGADIGMEKFFNIKCRYSGLCPHVVVLVAT    631 - 700
VRALKMHGGGPTVTAGLPLPKAYIQENLELVEKGFSNLKKQIENARMFGIPVVVAVNAFKTDTESELDLI    701 - 770
SRLSREHGAFDAVKCTHWAEGGKGALALAQAVQRAAQAPSSFQLLYDLKLPVEDKIRIIAQKIYGADDIE    771 - 840
LLPEAQHKAEVYTKQGFGNLPICMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTM    841 - 910
PGLPTRPCFYDIDLDPETEQVNGLF                                                 911 - 935
//

Text Mined References (156)

PMID Year Title