Property Summary

NCBI Gene PubMed Count 650
Grant Count 1,238
R01 Count 660
Funding $157,201,914.49
PubMed Score 2296.54
PubTator Score 1509.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical adenoma -1.748 0.005
adrenocortical carcinoma -1.429 0.029
interstitial cystitis 1.500 0.026
ovarian cancer -1.800 0.000

Synonym

Accession P11511 Q16731 Q3B764 Q58FA0 Q8IYJ7
Symbols ARO
ARO1
CPV1
CYAR
CYP19
CYPXIX
P-450AROM

Gene

PANTHER Protein Class (2)

PDB

1TQA   3EQM   3S79   3S7S   4GL5   4GL7   4KQ8  

Gene RIF (695)

PMID Text
27012050 T allele of rs2289105 in CYP19 gene might be a protective genetic marker of essential hypertension for women in Han population.
26706698 EGb 761 reduced the tumor size and significantly reduced tumor CYP19 mRNA expression.
26631403 These findings contribute in clarifying the relationship between hormones regulating the early phase of steroidogenesis confirming that AMH is playing a suppressive role on CYP19A1 expression stimulated by gonadotropin in hGCs. Furthermore, a similar inhibitory effect for AMH was observed on P450scc gene expression when activated by gonadotropin treatment.
26574572 Higher CYP19A1 expression and E2 concentrations are associated with increased risk of endometrial cancer.
26562495 The CT genotype of the rs2289105 polymorphism in the CYP19 gene is associated with a decreased risk of CHD and may be a genetic marker of protection from CHD
26426292 study to determine distribution of CYP19(TTTA)n polymorphism in Mexican general population and search for associations of particular genotypes with hip fracture and lumbar spine osteoporosis; the A1 allele and the A1A1 genotype were associated with an elevated risk of fracture; the A2 allele was associated with protection of hip fracture as the A2A2 genotype
26415088 The CYP19A1 rs10046 polymorphism is associated with cardiovascular risk factors such as circulating apoB, insulin resistance and hypertension in a sex- and obesity-specific manner.
26394174 Data suggest PGE2 induces aromatase and ERB/ESR2 expression by interacting with c-Jun and p38a/MAPK14, thus influencing estradiol production in endometrial stromal cells; inactivation of c-Jun and p38a may be effective in treatment of endometriosis.
26345775 the relationship between CYP19 gene polymorphisms and breast cancer in Xinjiang Uigur women was investigated.
26323233 Our findings suggested that CYP19A1 and HSD17B2 polymorphisms might be associated with circulating sex hormone levels in Japanese postmenopausal women, independent of current BMI.
More...

AA Sequence

MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGI      1 - 70
GSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPEL     71 - 140
WKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDE    141 - 210
SAIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFAT    211 - 280
ELILAEKRGDLTRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDI    281 - 350
QKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK    351 - 420
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLHPDETKNMLEM    421 - 490
IFTPRNSDRCLEH                                                             491 - 503
//

Text Mined References (653)

PMID Year Title
27067638 2016 Aromatase expression and regulation in breast and endometrial cancer.
27012050 2016 A Novel Polymorphism of the CYP19 Gene is Associated with Essential Hypertension in China.
26706698 2016 Ginkgo biloba extract EGb 761-mediated inhibition of aromatase for the treatment of hormone-dependent breast cancer.
26631403 2016 The anti-Müllerian hormone (AMH) acts as a gatekeeper of ovarian steroidogenesis inhibiting the granulosa cell response to both FSH and LH.
26574572 2016 CYP19A1 fine-mapping and Mendelian randomization: estradiol is causal for endometrial cancer.
26562495 2016 Identification of a CYP19 Gene Single-Nucleotide Polymorphism Associated with a Reduced Risk of Coronary Heart Disease.
26426292 2015 Association of a (TTTA)n microsatellite and a TCT del/ins polymorphisms in the aromatase gene (CYP19) with hip fracture risk in Mexican postmenopausal women.
26415088 2015 Sex- and Obesity-specific Association of Aromatase (CYP19A1) Gene Variant with Apolipoprotein B and Hypertension.
26394174 2015 C-Jun NH2-Terminal Kinase and p38 Inhibition Suppresses Prostaglandin E2-Stimulated Aromatase and Estrogen Receptor Levels in Human Endometriosis.
26345775 2015 CYP19 gene polymorphisms and the susceptibility to breast cancer in Xinjiang Uigur women.
More...