Property Summary

NCBI Gene PubMed Count 255
Grant Count 128
R01 Count 70
Funding $24,675,688.5
PubMed Score 676.80
PubTator Score 666.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.000

Synonym

Accession P11509 A7YAE5 B2R7F6 P00190 P10890 Q16803 Q4VAT9 Q4VAU0 Q4VAU1 Q9H1Z7 Q9UCU0 Q9UK48
Symbols CPA6
CYP2A
CYP2A3
P450PB
CYPIIA6
P450C2A

Gene

PDB

1Z10   1Z11   2FDU   2FDV   2FDW   2FDY   3EBS   3T3Q   3T3R   4EJJ   4RUI  

Gene RIF (264)

PMID Text
26818358 carcinogen exposure and thereby lower risk of lung cancer. Despite the association between nicotine metabolism (CYP2A6 activity phenotype and diplotypes) and smoking intensity
26757861 No associations were found between the analyzed variants and smoking, however, there was an association among non-smoking subjects between the A allele of rs16969968 and high body mass index.
26725431 It was concluded that, although decreased CYP2A6 AS tended to reduce the risk of bladder cancer in Japanese smokers, no significant association was recognized in this population.
26662855 lower lung cancer risk observed in CYP2A6 poor metabolizers is partially explained by the strong influence of CYP2A6 genetic polymorphisms on nicotine uptake and metabolism
26644138 Slow nicotine metabolism mediated by CYP2A6 increases risk for tobacco dependence throughout adolescence.
26407342 The detected CYP2A6 variants explain a strikingly large fraction of variance (up to 31%) in nicotine metabolite ratio (NMR) in these study samples.
26366873 Optical Isomers of Atorvastatin, Rosuvastatin and Fluvastatin Enantiospecifically Activate Pregnane X Receptor PXR and Induce CYP2A6, CYP2B6 and CYP3A4 in Human Hepatocytes.
26343999 We have for the first time demonstrated that the tumor suppressor protein, p53, is a regulator of the CYP2A6 gene.
26247835 P450 2A13 is one of the important enzymes that oxidizes polycyclic aromatic hydrocarbons
26098700 phenotypic association studies in population in Nigeria: Data suggest polymorphisms in CYP2A6 exist in the population studied; distribution of CYP2A6 activity is trimodal; influence of age/sex on activity are not significant in this biomarker study.
More...

AA Sequence

MLASGMLLVALLVCLTVMVLMSVWQQRKSKGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFT      1 - 70
IHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVVFSNGERAKQLRRFSIATLRDFGV     71 - 140
GKRGIEERIQEEAGFLIDALRGTGGANIDPTFFLSRTVSNVISSIVFGDRFDYKDKEFLSLLRMMLGIFQ    141 - 210
FTSTSTGQLYEMFSSVMKHLPGPQQQAFQLLQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEK    211 - 280
NPNTEFYLKNLVMTTLNLFIGGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMP    281 - 350
YMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLNEK    351 - 420
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMS    421 - 490
FLPR                                                                      491 - 494
//

Text Mined References (261)

PMID Year Title
26818358 2016 Genetic determinants of CYP2A6 activity across racial/ethnic groups with different risks of lung cancer and effect on their smoking intensity.
26757861 2015 [Association between genotype and allele frequencies of CYP2A6*12 and rs16969968 in CHRNA5 variants with smoking and body mass index in young subjects from Northeast Mexico].
26725431 2016 Genetic Polymorphisms of CYP2A6 in a Case-Control Study on Bladder Cancer in Japanese Smokers.
26662855 2016 Genetic determinants of cytochrome P450 2A6 activity and biomarkers of tobacco smoke exposure in relation to risk of lung cancer development in the Shanghai cohort study.
26644138 2016 Variation in CYP2A6 and tobacco dependence throughout adolescence and in young adult smokers.
26407342 2015 A Genome-Wide Association Study of a Biomarker of Nicotine Metabolism.
26366873 2015 Optical Isomers of Atorvastatin, Rosuvastatin and Fluvastatin Enantiospecifically Activate Pregnane X Receptor PXR and Induce CYP2A6, CYP2B6 and CYP3A4 in Human Hepatocytes.
26343999 2015 Tumour suppressor protein p53 regulates the stress activated bilirubin oxidase cytochrome P450 2A6.
26247835 2016 Oxidation of pyrene, 1-hydroxypyrene, 1-nitropyrene and 1-acetylpyrene by human cytochrome P450 2A13.
26098700 2015 Polymorphisms of CYP1A2 and CYP2A6 activity: phenotypes and the effect of age and sex in a Nigerian population.
More...