Property Summary

NCBI Gene PubMed Count 36
Grant Count 106
R01 Count 72
Funding $14,942,987.14
PubMed Score 349.85
PubTator Score 3927.91

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P11498 B4DN00 Q16705
Symbols PCB

Gene

PC

PANTHER Protein Class (1)

PDB

3BG3   3BG9  

 GWAS Trait (1)

Gene RIF (14)

PMID Text
25607840 These findings indicate that PC-mediated anaplerosis in early-stage NSCLC is required for tumor survival and proliferation.
25243911 PC and PDH may be an important part of cellular adaptation to the IDH1 mutation and may serve as potential therapeutic targets
23383084 characterization of PC distal promoter
23294723 Increased PC expression is correlated with the malignant progression of GC, which might be a potential target for GC biotherapy.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20807508 PC protein is easily detectable by streptavidin blot and the presence of considerable amounts of PC in cultured human myotubes and in human muscle tissue was shown.
19306334 Nine novel mutations of the PC gene, in five unrelated patients, are reported.
19296078 The activities of pyruvate carboxylase (PC) were decreased by 65% in pancreatic islets of patients with type 2 diabetes.
19004141 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18676167 Eight novel mutations were identified in PC from 8 pyruvate carboxylase deficiency patients.
More...

AA Sequence

MLKFRTVHGGLRLLGIRRTSTAPAASPNVRRLEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQ      1 - 70
DTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIG     71 - 140
PSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSY    141 - 210
EELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPA    211 - 280
AHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDRHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIH    281 - 350
VAEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISP    351 - 420
HYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIAFLQNVLNNQQFLAGTVDTQFIDENPELFQL    421 - 490
RPAQNRAQKLLHYLGHVMVNGPTTPIPVKASPSPTDPVVPAVPIGPPPAGFRDILLREGPEGFARAVRNH    491 - 560
PGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFSKLFSMENWGGATFDVAMRFLYECPWRRLQEL    561 - 630
RELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVV    631 - 700
EAAISYTGDVADPSRTKYSLQYYMGLAEELVRAGTHILCIKDMAGLLKPTACTMLVSSLRDRFPDLPLHI    701 - 770
HTHDTSGAGVAAMLACAQAGADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEG    771 - 840
ARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPS    841 - 910
SKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGVPHGGFPEPFRSKVLKDLPRVEGRPGA    911 - 980
SLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEV    981 - 1050
ELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKV   1051 - 1120
IDIKVVAGAKVAKGQPLCVLSAMKMETVVTSPMEGTVRKVHVTKDMTLEGDDLILEIE               1121 - 1178
//

Text Mined References (41)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25607840 2015 Pyruvate carboxylase is critical for non-small-cell lung cancer proliferation.
25243911 2014 Glioma cells with the IDH1 mutation modulate metabolic fractional flux through pyruvate carboxylase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23861867 2013 Nonstructural 5A protein of hepatitis C virus interacts with pyruvate carboxylase and modulates viral propagation.
23383084 2013 Characterization of the distal promoter of the human pyruvate carboxylase gene in pancreatic beta cells.
23294723 2013 [Expression and clinical significance of pyruvate carboxylase in gastric adenocarcinoma].
22174851 2011 Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21269460 2011 Initial characterization of the human central proteome.
More...