Property Summary

NCBI Gene PubMed Count 40
Grant Count 68
R01 Count 40
Funding $5,141,873.7
PubMed Score 189.47
PubTator Score 248.84

Knowledge Summary

Patent

No data available

Synonym

Accession P11487 Q0VG69 FGF-3
Symbols INT2
HBGF-3

Gene

PANTHER Protein Class (2)

Gene RIF (20)

PMID Text
26421711 MCF7 cells over-expressing both WNT1 and FGF3 show a 3.5-fold increase in mammosphere formation; conditioned media from these cells also promotes stem cell activity in untransfected parental MCF7 and T47D cells, as WNT1 and FGF3 are secreted factors.
25333703 FGF3 gene expression is altered in a human breast cancer progression model.
24920722 Higher FGF-23 concentration was associated with LVED mass and with incident atrial fibrillation and may, in part, explain the link between chronic kidney disease and AF.
24697712 analysis provided evidence for gene-gene interaction between FGF3 (rs4980700) and PAX9 (rs2073242), increasing risk for isolated oral clefts (p = 0.0003). FGF3 is associated with oral clefts and may interact with PAX9.
24661680 haplotypes may contribute to the tendon disease process in elite volleyball athletes
24120895 A de novo 290 kb interstitial duplication of chromosome 11q13.3 including the FGF3 and FGF4 genes.
23169889 tooth agenesis had increased risk of a family history of cancer. tooth agenesis was associated with positive self-reported family history of cancer and variants in FGF3.
21480479 confirm the absence of otodental syndrome in heterozygous FGF3 carriers, but report unilateral microtia in one of them
21359960 This study is the first to show a significant association between coronary calcification and elevated serum FGF 23 in children.
21306635 Manifestations of recessive FGF3 mutations range from fully penetrant LAMM syndrome to deafness with residual inner ear structures and, by extension, with minimal syndromic features.
More...

AA Sequence

MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLEN      1 - 70
SAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSST     71 - 140
PGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRR    141 - 210
RRQKQSPDNLEPSHVQASRLGSQLEASAH                                             211 - 239
//

Text Mined References (40)

PMID Year Title
26421711 2015 Mitochondrial mass, a new metabolic biomarker for stem-like cancer cells: Understanding WNT/FGF-driven anabolic signaling.
25333703 2014 Allelic loss at chromosome 11q13 alters FGF3 gene expression in a human breast cancer progression model.
24920722 2014 Fibroblast growth factor-23 and incident atrial fibrillation: the Multi-Ethnic Study of Atherosclerosis (MESA) and the Cardiovascular Health Study (CHS).
24697712 2014 Studies of genes involved in craniofacial development and tumorigenesis: FGF3 contributes to isolated oral clefts and may interact with PAX9.
24661680 2015 BMP4 and FGF3 haplotypes increase the risk of tendinopathy in volleyball athletes.
24120895 2014 Increased FGF3 and FGF4 gene dosage is a risk factor for craniosynostosis.
23169889 2013 Tooth agenesis association with self-reported family history of cancer.
21480479 2011 LAMM syndrome with middle ear dysplasia associated with compound heterozygosity for FGF3 mutations.
21359960 2011 Elevated FGF 23 and phosphorus are associated with coronary calcification in hemodialysis patients.
21306635 2011 Variable expressivity of FGF3 mutations associated with deafness and LAMM syndrome.
More...