Property Summary

NCBI Gene PubMed Count 41
PubMed Score 192.65
PubTator Score 248.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
lung cancer 4740 1.1e-03
Disease Target Count Z-score Confidence
Cancer 2499 3.728 1.9

Gene RIF (21)

AA Sequence

MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLEN      1 - 70
SAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSST     71 - 140
PGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRR    141 - 210
RRQKQSPDNLEPSHVQASRLGSQLEASAH                                             211 - 239
//

Text Mined References (41)

PMID Year Title