Property Summary

NCBI Gene PubMed Count 121
Grant Count 90
R01 Count 56
Funding $10,234,867.59
PubMed Score 151.90
PubTator Score 169.98

Knowledge Summary

Patent (7,551)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
adult high grade glioma -1.100 0.001

Synonym

Accession P11474 Q14514
Symbols ERR1
ERRa
ESRL1
NR3B1
ERRalpha

Gene

PDB

1XB7   2PJL   3D24   3K6P  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (104)

PMID Text
26744532 CD68(+)CD163(+) macrophages secreted cytokines, such as IL17A, that upregulated ERalpha expression.
26639757 Over-expression of ESRRA due to its gene amplification in OSCC
26586335 ERRalpha suppression inhibits angiogenesis in HUVECs
26312764 Incomplete autophagy and cell death by a necrotic processes, as a consequence of the cell energy failure, induced by pharmacological reduction of ERRalpha in adrenocortical carcinoma cells.
26160845 Inhibition of ERRalpha suppresses epithelial mesenchymal transition of triple negative breast cancer cells by directly targeting fibronectin.
25912138 targeting of ERRalpha and pathways regulating transcriptional HIF-2alpha are promising therapeutic avenues in neuroblastoma
25903400 An ERRalpha 23-repeats polymorphisms with BMD in postmenopausal Egyptian women.
25865501 mediates metabolic transition, which is required for induced pluripotency
25643697 our results suggest that ERalpha and ERRalpha cooperate to promote endocrine resistance, and they provide a rationale for the exploration of ERRalpha as a candidate drug target to treat endocrine-resistant breast cancer
25480584 ERRalpha promoted the migration and invasion of A549 cells by inducing EMT, and Slug was involved in the process. Targeting ERRalpha might be an efficient approach for lung cancer treatment.
More...

AA Sequence

MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLV      1 - 70
LSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCL     71 - 140
RVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVNALVSHLLVVEPEKLY    141 - 210
AMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPL    211 - 280
QDELAFAEDLVLDEEGARAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQ    281 - 350
LREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA    351 - 420
MMD                                                                       421 - 423
//

Text Mined References (129)

PMID Year Title
26744532 2016 Infiltrating Macrophages Induce ER? Expression through an IL17A-mediated Epigenetic Mechanism to Sensitize Endometrial Cancer Cells to Estrogen.
26639757 2015 Genomic amplification upregulates estrogen-related receptor alpha and its depletion inhibits oral squamous cell carcinoma tumors in vivo.
26586335 2015 Downregulation of ERR? inhibits angiogenesis in human umbilical vein endothelial cells through regulating VEGF production and PI3K/Akt/STAT3 signaling pathway.
26312764 2015 Estrogen related receptor ? (ERR?) a promising target for the therapy of adrenocortical carcinoma (ACC).
26160845 2015 Inhibition of ERR? suppresses epithelial mesenchymal transition of triple negative breast cancer cells by directly targeting fibronectin.
25912138 2015 Differential regulation of HIF-1? and HIF-2? in neuroblastoma: Estrogen-related receptor alpha (ERR?) regulates HIF2A transcription and correlates to poor outcome.
25903400 2015 Association of estrogen receptor ? and estrogen-related receptor ? gene polymorphisms with bone mineral density in postmenopausal women.
25865501 2015 ERRs Mediate a Metabolic Switch Required for Somatic Cell Reprogramming to Pluripotency.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
More...