Property Summary

NCBI Gene PubMed Count 1,525
Grant Count 853
R01 Count 515
Funding $117,199,905.9
PubMed Score 3546.78
PubTator Score 4357.85

Knowledge Summary

Patent (27,459)

TINX Plot

  Disease Relevance (66)

Disease Z-score Confidence
Rickets 42 6.275 3.1
Osteoporosis 257 5.953 3.0
Hyperparathyroidism 43 5.872 2.9
Hypercalcemia 37 5.125 2.6
Cancer 2,346 5.117 2.6
Alopecia 55 4.95 2.5
Kidney disease 396 4.84 2.4
Osteomalacia 28 4.584 2.3
tuberculosis 1,557 4.399 2.2
diabetes mellitus 1,663 4.268 2.1
psoriasis 6,685 4.163 2.1
Hyperphosphatemia 32 4.043 2.0
Multiple Sclerosis 498 4.04 2.0
Hypersensitivity reaction type II diseas... 235  4.002 2.0
Hypophosphatemia 31 3.958 2.0
Inflammatory bowel disease 142 3.546 1.8
Degenerative disc disease 28 3.53 1.8
Leber congenital amaurosis 72 3.498 1.7
Hypervitaminosis D 8 3.303 1.7
Arthritis 248 3.253 1.6
periodontitis 269 3.108 1.6
Hypertension 287 3.072 1.5
Carcinoma, Transitional Cell 31
Chronic Lymphocytic Leukemia 242
Epilepsy, Temporal Lobe 23
Familial x-linked hypophosphatemic vitam... 1 
Glucocorticoid Induced Osteoporosis 4
Hyperparathyroidism Secondary to Chronic... 2 
Hyperparathyroidism Secondary to Chronic... 2 
Hypertensive disease 193
Hypocalcemia 5
Hypocalcemia from End-Stage Renal Diseas... 2 
Hypogonadal Osteoporosis in Males 4
Hypoparathyroidism 29
Lead Poisoning 6
Mammary Neoplasms 410
Neonatal hypocalcemia 1
Plaque psoriasis 14
Postmenopausal osteoporosis 19
Prevention of dental caries 2
Prostatic Neoplasms 471
Renal osteodystrophy 10
Scalp psoriasis 6
Uremia 19
Vitamin D Deficiency 5
Vitamin D Dependent Rickets 1
Vitamin D-Dependent Rickets, Type 2A 1
Vitamin Deficiency Prevention 2
Vitamin deficiency 3
aldosterone-producing adenoma 664
ductal carcinoma in situ 1,745
fibroadenoma 557
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
nephrosclerosis 329
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
ulcerative colitis 2,087

Expression

  Differential Expression (18)

Disease log2 FC p
nephrosclerosis -1.612 0.018
malignant mesothelioma -2.500 0.000
osteosarcoma -2.189 0.007
tuberculosis -1.800 0.000
primary pancreatic ductal adenocarcinoma 1.257 0.004
intraductal papillary-mucinous neoplasm ... 2.000 0.012
lung cancer -1.900 0.000
pancreatic cancer 1.200 0.001
fibroadenoma 1.800 0.027
posterior fossa group A ependymoma 1.500 0.000
aldosterone-producing adenoma 1.487 0.044
lung adenocarcinoma 1.200 0.000
invasive ductal carcinoma 1.299 0.005
lung carcinoma -1.400 0.000
ductal carcinoma in situ 1.400 0.004
ulcerative colitis -1.100 0.000
ovarian cancer 4.100 0.000
pituitary cancer -1.100 0.001

Synonym

Accession P11473 B2R5Q1 G3V1V9 Q5PSV3 VDR
Symbols NR1I1
PPP1R163

Gene

VDR

PDB

1DB1   1IE8   1IE9   1KB2   1KB4   1KB6   1S0Z   1S19   1TXI   1YNW   2HAM   2HAR   2HAS   2HB7   2HB8   3A2I   3A2J   3A3Z   3A40   3A78   3AUQ   3AUR   3AX8   3AZ1   3AZ2   3AZ3   3B0T   3CS4   3CS6   3KPZ   3M7R   3OGT   3P8X   3TKC   3VHW   3W0A   3W0C   3W0Y   3WGP   3WWR   3X31   3X36   4G2I   4ITE   4ITF   4PA2  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504847 confirmatory 3735 / 13228 / 384189 Inhibitors of the vitamin D receptor (VDR): qHTS
504855 summary 0 / 0 / 0 Inhibitors of the vitamin D receptor (VDR): Summary
602199 confirmatory 746 / 89 / 0 qHTS for Inhibitors of the vitamin D receptor (VDR): Hit Validation in Primary Screen
602200 confirmatory 399 / 389 / 47 qHTS for Inhibitors of the vitamin D receptor (VDR): Hit Validation using a Fluorescein Assay
602201 confirmatory 163 / 557 / 115 qHTS for Inhibitors of the vitamin D receptor (VDR): Hit Validation using a Texas Red Assay
602202 confirmatory 189 / 247 / 399 qHTS for Inhibitors of the vitamin D receptor (VDR): Hit Validation using a Beta-Lactamase Assay

Gene RIF (1752)

PMID Text
27440697 the association between polymorphisms of BsmI and FokI in the VDR gene and type 2 diabetes mellitus risk (Meta-Analysis)
27228639 There is association between vitamin D receptor (VDR) gene polymorphisms and the risk of Systemic Lupus Erythematosus.
27164626 The VDR Fok1, TaqI, and ApaI gene polymorphisms were not associated with the risk of atopic dermatitis in the Turkish population but the BsmI polymorphism was found to increase risk.
27049563 There was no association between serum vitamin D or A or VDR genotypes and multiple sclerosis.
26969398 down-regulation of the level of RAR alpha leads to increased expression of VDR in acute myeloid leukemia.
26911666 Vitamin D related (VDR rs2228570 and CYP2R1 rs10741657) and IL28B rs12979860 genes polymorphisms accurately assure sustained viral response in naive CHC G4 patients treated with low cost standard therapy.
26907966 Increased VDR expression in human thyroid cancer cells is often linked to increased ECM1 and/or TPMRSS4 expression.
26894582 findings suggest that polymorphisms in the VDR gene may affect immune activation and the clinical outcome of B. pertussis infection
26845840 The presence of the VDR genotype CC TaqI decreased the risk of postmenopausal osteoporosis by 5.5 times, and of the genotype TT TaqI increased the risk by 5.4 times.
26784653 findings show a significant association between VDR ApaI and TaqI gene polymorphisms and the GDM at the investigated loci
More...

AA Sequence

MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITK      1 - 70
DNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHH     71 - 140
KTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEE    141 - 210
DSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFT    211 - 280
MDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAA    281 - 350
LIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE    351 - 420
VFGNEIS                                                                   421 - 427
//

Text Mined References (1534)

PMID Year Title
27440697 2016 The genetic polymorphisms in vitamin D receptor and the risk of type 2 diabetes mellitus: an updated meta-analysis.
27228639 Vitamin D and Systemic Lupus Erythematosus: Myth or Reality?
27164626 2016 Vitamin D Receptor Gene BSMI, FOKI, APAI, and TAQI Polymorphisms and the Risk of Atopic Dermatitis.
27049563 2016 Vitamin D receptor biochemical and genetic profiling and HLA-class II genotyping among Lebanese with multiple sclerosis - A pilot study.
26969398 2016 Regulation of vitamin D receptor expression by retinoic acid receptor alpha in acute myeloid leukemia cells.
26911666 2016 Integrative role of vitamin D related and Interleukin-28B genes polymorphism in predicting treatment outcomes of Chronic Hepatitis C.
26907966 2016 Vitamin D receptor expression is linked to potential markers of human thyroid papillary carcinoma.
26894582 2016 Association of Vitamin D Receptor Polymorphism with Susceptibility to Symptomatic Pertussis.
26845840 2015 Influence of single nucleotide polymorphisms of vitamin D receptor-gene on the level of osteoassociated hormones linkage with postmenopausal osteoporosis.
26784653 2016 Association between vitamin D receptor ApaI and TaqI gene polymorphisms and gestational diabetes mellitus in an Iranian pregnant women population.
More...