Property Summary

NCBI Gene PubMed Count 14
PubMed Score 18.23
PubTator Score 2.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.0e-02
medulloblastoma, large-cell 1.400 2.4e-04
psoriasis 1.300 1.6e-05

Gene RIF (3)

AA Sequence

MGPLSAPPCTEHIKWKGLLVTASLLNFWNLPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLTGYIWYKG      1 - 70
QIRDLYHYITSYVVDGQIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKRGDGTRGVTGYFTF     71 - 140
TLYLETPKPSISSSNLNPREAMETVILTCDPETPDTSYQWWMNGQSLPMTHRFQLSETNRTLFLFGVTKY    141 - 210
TAGPYECEIRNSGSASRSDPVTLNLLHGPDLPRIHPSYTNYRSGDNLYLSCFANSNPPAQYSWTINGKFQ    211 - 280
QSGQNLFIPQITTKHSGLYVCSVRNSATGEESSTSLTVKVSASTRIGLLPLLNPT                   281 - 335
//

Text Mined References (14)

PMID Year Title