Property Summary

NCBI Gene PubMed Count 37
PubMed Score 31.16
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus 1.700 1.1e-03
malignant mesothelioma -3.200 7.9e-08
medulloblastoma, large-cell 1.200 5.4e-04
osteosarcoma 1.833 6.7e-08
ovarian cancer 1.300 2.4e-09
X-linked cerebral adrenoleukodystrophy -1.500 3.3e-02

Gene RIF (9)

AA Sequence

MGTLSAPPCTQRIKWKGLLLTASLLNFWNLPTTAQVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKG      1 - 70
QMRDLYHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTF     71 - 140
TLHLETPKPSISSSNLNPRETMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLKLSETNRTLFLLGVTKY    141 - 210
TAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSL    211 - 280
PVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVL    281 - 350
YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSATGKESSKSMTVEVSDWTVP     351 - 419
//

Text Mined References (37)

PMID Year Title