Property Summary

NCBI Gene PubMed Count 32
Grant Count 4
Funding $588,771.17
PubMed Score 30.98
PubTator Score 3.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -3.200 0.000
osteosarcoma 1.833 0.000
medulloblastoma, large-cell 1.200 0.001
X-linked cerebral adrenoleukodystrophy -1.500 0.033
diabetes mellitus 1.700 0.001
ovarian cancer -1.400 0.000

Gene RIF (5)

PMID Text
21193412 the presence of GAGs on the surface of endothelial cells was required for the ability of PSG1 to induce tube formation
20335639 The aspartic acid at position 95 is not required for PSG1 activity but the amino acids implicated in the formation of a salt bridge within the N-domain are essential.
19911417 first trimester maternal serum marker of small-for-gestational age and preterm delivery
18987160 The differential expression of HLA-E and PSG1 in the sperm of fertile and infertile men is discussed.
12223519 Human PSG1a induces alternative activation in human & mouse monocytes & suppresses the accessory-cell-dependent T-cell proliferation. PSG1a contributes to immunomodulation during pregnancy, with opposite effects on maternal innate & adaptative systems.

AA Sequence

MGTLSAPPCTQRIKWKGLLLTASLLNFWNLPTTAQVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKG      1 - 70
QMRDLYHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTF     71 - 140
TLHLETPKPSISSSNLNPRETMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLKLSETNRTLFLLGVTKY    141 - 210
TAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSL    211 - 280
PVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVL    281 - 350
YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSATGKESSKSMTVEVSDWTVP     351 - 419
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21193412 2011 Pregnancy-specific glycoprotein 1 induces endothelial tubulogenesis through interaction with cell surface proteoglycans.
20335639 2010 Human pregnancy specific beta-1-glycoprotein 1 (PSG1) has a potential role in placental vascular morphogenesis.
19911417 2009 First trimester maternal serum pregnancy-specific beta-1-glycoprotein (SP1) as a marker of adverse pregnancy outcome.
18987160 2009 Pregnancy-specific {beta}-1-glycoprotein 1 and human leukocyte antigen-E mRNA in human sperm: differential expression in fertile and infertile men and evidence of a possible functional role during early development.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...