Property Summary

NCBI Gene PubMed Count 293
Grant Count 201
R01 Count 92
Funding $43,757,352.09
PubMed Score 10.48
PubTator Score 6611.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 1.900 0.001
glioblastoma 1.500 0.001
tuberculosis 1.900 0.000
lung cancer 1.300 0.006
subependymal giant cell astrocytoma 1.181 0.028
Breast cancer 1.500 0.000
invasive ductal carcinoma 1.200 0.021
acute myeloid leukemia 1.200 0.003

Synonym

Gene

PANTHER Protein Class (2)

PDB

1QKI   2BH9   2BHL  

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
504792 confirmatory 39 / 0 / 548 Human Glucose-6-Phosphate Dehydrogenase Dose Response Selectivity Assay for Inhibitors of Plasmodium falciparum Glucose-6-Phosphate Dehydrogenase
588414 confirmatory 0 / 0 / 68 SAR analysis of small molecule inhibitors of Plasmodium falciparum Glucose-6-Phosphate Dehydrogenase using a Human Glucose-6-Phosphate Dehydrogenase Dose Response Selectivity Assay
588672 confirmatory 0 / 0 / 30 SAR analysis of small molecule inhibitors of Plasmodium falciparum Glucose-6-Phosphate Dehydrogenase using a Human Glucose-6-Phosphate Dehydrogenase Dose Response Selectivity Assay - Set 2
602130 confirmatory 0 / 0 / 24 SAR analysis of small molecule inhibitors of Plasmodium falciparum Glucose-6-Phosphate Dehydrogenase using a Human Glucose-6-Phosphate Dehydrogenase Dose Response Selectivity Assay - Set 3
602424 confirmatory 0 / 0 / 17 SAR analysis of small molecule inhibitors of Plasmodium falciparum Glucose-6-Phosphate Dehydrogenase using a Human Glucose-6-Phosphate Dehydrogenase Dose Response Selectivity Assay - Set 4

Gene RIF (252)

PMID Text
27097228 G6PD deficiency affects the cellular inflammatory response and the decreased TNF-alpha-mediated antiviral response in G6PD-kd A549 cells is a result of dysregulated NOX/MAPK/NF-kappaB/COX-2 signaling
26976705 Transgenic mice moderately overexpressing G6PD have higher levels of NADPH, lower levels of ROS-derived damage, and better protection from ageing-associated functional decline, including extended median lifespan in females.
26840990 study demonstrated that G6PD molecular deficiency was not associated either with clinical ischemic stroke
26829728 Mutation of G6PD is associated with G6PD deficiency in Chinese population.
26823837 This is the first report of G6PD deficiency among Chinese Hakka population in Jiangxi province.
26694452 These findings suggest that the increased susceptibility of the G6PD-knockdown cells to viral infection was due to impaired NF-kappaB signaling and antiviral response mediated by HSCARG.
26621836 Data indicate a tumor suppressor-like function of Bcl-2 associated athanogene 3 (BAG3) via direct interaction with glucose 6 phosphate dehydrogenase (G6PD) in hepatocellular carcinomas (HCCs) at the cellular level.
26607846 Overexpression of G6PD is associated with high risks of recurrent metastasis in primary breast carcinoma.
26399441 G6PD glycosylation is increased in human lung cancers. Glycosylation activates G6PD activity and increases glucose flux through the PPP, thereby providing precursors for nucleotide and lipid biosynthesis, and reducing equivalents for antioxidant defense.
26139767 G6PD deficiency is an example of balanced polymorphism, in which high rate of mortality caused by this disorder is offset by the protection that it offers against Plasmodium falciparum malaria
More...

AA Sequence

MAEQVALSRTQVCGILREELFQGDAFHQSDTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTFIVGY      1 - 70
ARSRLTVADIRKQSEPFFKATPEEKLKLEDFFARNSYVAGQYDDAASYQRLNSHMNALHLGSQANRLFYL     71 - 140
ALPPTVYEAVTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYRIDHYLGKEMVQN    141 - 210
LMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPASTN    211 - 280
SDDVRDEKVKVLKCISEVQANNVVLGQYVGNPDGEGEATKGYLDDPTVPRGSTTATFAAVVLYVENERWD    281 - 350
GVPFILRCGKALNERKAEVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESEL    351 - 420
DLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPT    421 - 490
EADELMKRVGFQYEGTYKWVNPHKL                                                 491 - 515
//

Text Mined References (302)

PMID Year Title
27097228 2016 Diminished COX-2/PGE2-Mediated Antiviral Response Due to Impaired NOX/MAPK Signaling in G6PD-Knockdown Lung Epithelial Cells.
26976705 2016 G6PD protects from oxidative damage and improves healthspan in mice.
26840990 2016 Glucose-6-Phosphate Dehydrogenase Deficiency in Brazilian Children With Sickle Cell Anemia is not Associated With Clinical Ischemic Stroke or High-Risk Transcranial Doppler.
26829728 2016 [Molecular epidemiology of G6PD deficiency in Chaozhou area of eastern Guangdong Province].
26823837 2015 Molecular epidemiological investigation of G6PD deficiency by a gene chip among Chinese Hakka of southern Jiangxi province.
26694452 2015 Glucose-6-Phosphate Dehydrogenase Enhances Antiviral Response through Downregulation of NADPH Sensor HSCARG and Upregulation of NF-?B Signaling.
26621836 2016 BAG3 elevation inhibits cell proliferation via direct interaction with G6PD in hepatocellular carcinomas.
26607846 2015 Overexpression of G6PD is associated with high risks of recurrent metastasis and poor progression-free survival in primary breast carcinoma.
26479991 2015 Severe G6PD Deficiency Due to a New Missense Mutation in an Infant of Northern European Descent.
26399441 2015 O-GlcNAcylation of G6PD promotes the pentose phosphate pathway and tumor growth.
More...