Property Summary

NCBI Gene PubMed Count 317
Grant Count 112
R01 Count 71
Funding $17,065,339.65
PubMed Score 662.28
PubTator Score 609.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (78)

Disease Z-score Confidence
Cancer 2,346 5.276 2.6
Acute lymphoid leukemia 25
Acute monocytic/monoblastic leukemia 1
Acute myeloid leukemia, disease 16
Acute promyelocytic leukemia, FAB M3 10
Adenoid Cystic Carcinoma 99
Asthma 349 2.0
Atopic dermatitis 944
Breast cancer 3,094
Burkitt's lymphoma 15
Carcinoma 2,147 1.0
Carcinoma of breast 11
Carcinoma of female breast 20
Diffuse non-Hodgkin's lymphoma, large ce... 12 
Disease Progression 125
Endometriosis 535
Erythroleukemia, FAB M6 1
Follicular non-Hodgkin's lymphoma 17
Glioma 65
Hodgkin's disease 18
IGA Glomerulonephritis 454
Invasive Bladder Malignancy 1
Kaposi's sarcoma 20
Kaposi's sarcoma associated with AIDS 1
Leukemia 88
Malignant tumor of lung 5
Malignant tumor of ovary 25
Malignant tumor of testis 11
Malignant tumor of thyroid gland 3
Malignant tumor of urinary bladder 1
Mammary Neoplasms 410
Metastatic Breast Carcinoma 21
Metastatic Gastric Cancer 1
Metastatic Prostate Carcinoma 18
Multiple myeloma 1,327
Nephroblastoma 45
Neural crest tumor 6
Neuroblastoma 78
Non-Hodgkin's lymphoma 22
Osteosarcoma of bone 6
Polycystic Ovary Syndrome 332
Prostatic Neoplasms 471
Relapsing remitting multiple sclerosis 14
Salivary Gland Neoplasms 45
Small cell carcinoma of lung 45
Soft or Connective Tissue Sarcoma 1
adrenocortical carcinoma 1,427
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
breast carcinoma 1,614
chronic rhinosinusitis 512
colon cancer 1,475
cystic fibrosis and chronic rhinosinusit... 213 
ductal carcinoma in situ 1,745
esophageal adenocarcinoma 737
glioblastoma 5,572
group 3 medulloblastoma 2,254
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798
oligodendroglioma 2,849
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic ductal adenocarcinoma liver m... 1,795 
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
primitive neuroectodermal tumor 3,031
psoriasis 6,685
ulcerative colitis 2,087

Expression

Synonym

Accession P11388 B2RTS1 Q71UN1 Q71UQ5 Q9HB24 Q9HB25 Q9HB26 Q9UP44 Q9UQP9
Symbols TOP2
TP2A

Gene

PDB

1LWZ   1ZXM   1ZXN   4FM9   4R1F  

Gene RIF (269)

PMID Text
26867764 The study is an open label, single arm, phase II study, investigating the efficacy of epirubicin in patients with oxaliplatin refractory colorectal cancer and with a cancer cell TOP2A/CEN-17 ratio >/= 1.5
26657567 Deletion or deficiency of PTEN leads to down regulation of TOP2A, dysfunction of the decatenation checkpoint and incomplete DNA decatenation in G2 and M phases.
26643143 PICH and Topo II cooperate to prevent chromosome missegregation events in mitosis.
26612825 during early development, TOP2A is likely to have a role in cell proliferation, whereas TOP2B is expressed in post-mitotic cells and may be important in controlling expression of long genes even at this early stage.
26588239 may be a useful biomarker in patients receiving adjuvant taxane-platinum regimens with moderate- to high-risk endometrial cancer
26560244 These studies revealed a relationship between TOP2A and androgen receptor signaling pathway that contributes to prostate cancer progression and confers sensitivity to treatments.
26252353 TUBB3, TOP2A, CYP19A1 and CYP2D6 gene expression, but not protein expression, was associated with patient survival in breast cancer .
26221582 b-ELE could inhibit the proliferation of HepG-2 cells and interfere with the expression and activity of TOPO I and TOPO IIa
26100858 Data show that TOP2A gene gain and protein over-expression might predict activity of PLD in platinum resistant/refractory EOC.
26081617 It might, therefore, be concluded that topoisomerase II enzyme may be involved in the repair of radiation-induced DNA damage and consequently its inhibition constitute a strategy for sensitizing tumour cells to ionizing radiation.
More...

AA Sequence

MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVGI      1 - 70
NYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPAL     71 - 140
IFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFN    141 - 210
GEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLD    211 - 280
ETGNSLKVIHEQVNHRWEVCLTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVA    281 - 350
VKAHQVKNHMWIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQ    351 - 420
VQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKI    421 - 490
LNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHN    491 - 560
WPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFAD    561 - 630
MKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFIN    631 - 700
KELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIIN    701 - 770
LAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEW    771 - 840
YIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIEELAPNQYVIS    841 - 910
GEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEEKLAEA    911 - 980
ERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNN    981 - 1050
QARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTD   1051 - 1120
SGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQ   1121 - 1190
VGLPGKGGKAKGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQ   1191 - 1260
RLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRAATKTKFTMDL   1261 - 1330
DSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFP   1331 - 1400
DETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPST   1401 - 1470
SDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF            1471 - 1531
//

Text Mined References (340)

PMID Year Title
26867764 2016 A phase II study of Epirubicin in oxaliplatin-resistant patients with metastatic colorectal cancer and TOP2A gene amplification.
26657567 2015 PTEN stabilizes TOP2A and regulates the DNA decatenation.
26643143 2015 PICH promotes sister chromatid disjunction and co-operates with topoisomerase II in mitosis.
26612825 2016 Distinct expression patterns for type II topoisomerases IIA and IIB in the early foetal human telencephalon.
26588239 2016 Evaluation of TOP2A as a Predictive Marker for Endometrial Cancer With Taxane-Containing Adjuvant Chemotherapy.
26560244 2015 Topoisomerase 2 Alpha Cooperates with Androgen Receptor to Contribute to Prostate Cancer Progression.
26252353 2015 RRM1, TUBB3, TOP2A, CYP19A1, CYP2D6: Difference between mRNA and protein expression in predicting prognosis of breast cancer patients.
26221582 2015 ?-Elemene Inhibits Cell Proliferation by Regulating the Expression and Activity of Topoisomerases I and II? in Human Hepatocarcinoma HepG-2 Cells.
26100858 2015 TOP2A gene copy gain predicts response of epithelial ovarian cancers to pegylated liposomal doxorubicin: TOP2A as marker of response to PLD in ovarian cancer.
26081617 2015 Inhibition of topoisomerase II? sensitizes FaDu cells to ionizing radiation by diminishing DNA repair.
More...