Property Summary

Ligand Count 21
NCBI Gene PubMed Count 345
PubMed Score 722.97
PubTator Score 609.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Asthma 385 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 5.342 2.7

Expression

  Differential Expression (35)

Disease log2 FC p
adrenocortical carcinoma 3.155 9.2e-05
adult high grade glioma 3.800 1.2e-05
astrocytoma 1.700 1.1e-06
Astrocytoma, Pilocytic 1.800 1.1e-04
Atopic dermatitis 1.900 1.3e-04
atypical teratoid / rhabdoid tumor 5.500 1.4e-11
Breast cancer 4.700 2.2e-02
breast carcinoma 1.700 2.1e-06
chronic rhinosinusitis 1.459 1.6e-02
colon cancer 1.500 3.1e-03
cystic fibrosis and chronic rhinosinusit... 1.586 5.5e-03
ductal carcinoma in situ 3.100 1.9e-02
Endometriosis 2.813 5.7e-03
ependymoma 1.100 2.8e-02
esophageal adenocarcinoma 1.400 3.1e-02
glioblastoma 4.600 3.5e-12
group 3 medulloblastoma 6.300 6.6e-13
interstitial cystitis 2.500 6.7e-03
intraductal papillary-mucinous adenoma (... 2.200 1.5e-02
intraductal papillary-mucinous carcinoma... 5.200 6.6e-05
intraductal papillary-mucinous neoplasm ... 4.900 1.7e-03
invasive ductal carcinoma 3.600 1.6e-03
lung adenocarcinoma 1.700 1.1e-10
lung cancer 5.000 8.8e-06
medulloblastoma, large-cell 6.500 2.4e-08
nasopharyngeal carcinoma 1.900 4.5e-03
non-small cell lung cancer 4.661 1.2e-42
oligodendroglioma 1.900 3.4e-05
ovarian cancer 2.700 1.3e-06
pancreatic cancer 2.400 1.5e-06
pancreatic ductal adenocarcinoma liver m... 1.423 1.4e-03
primary Sjogren syndrome 1.400 5.2e-03
primitive neuroectodermal tumor 6.300 8.5e-09
psoriasis 2.100 7.6e-06
ulcerative colitis 1.300 1.7e-04

Gene RIF (295)

AA Sequence

MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVGI      1 - 70
NYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPAL     71 - 140
IFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFN    141 - 210
GEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLD    211 - 280
ETGNSLKVIHEQVNHRWEVCLTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVA    281 - 350
VKAHQVKNHMWIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQ    351 - 420
VQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKI    421 - 490
LNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHN    491 - 560
WPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFAD    561 - 630
MKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFIN    631 - 700
KELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIIN    701 - 770
LAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEW    771 - 840
YIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIEELAPNQYVIS    841 - 910
GEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEEKLAEA    911 - 980
ERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNN    981 - 1050
QARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTD   1051 - 1120
SGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQ   1121 - 1190
VGLPGKGGKAKGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQ   1191 - 1260
RLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRAATKTKFTMDL   1261 - 1330
DSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFP   1331 - 1400
DETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPST   1401 - 1470
SDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF            1471 - 1531
//

Text Mined References (369)

PMID Year Title