Property Summary

NCBI Gene PubMed Count 225
Grant Count 614
R01 Count 355
Funding $113,779,484.12
PubMed Score 3912.39
PubTator Score 487.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.300 0.000
astrocytoma 1.100 0.004
juvenile dermatomyositis 1.262 0.000
acute quadriplegic myopathy 1.037 0.000
colon cancer 1.700 0.025

Synonym

Gene

PDB

1A31   1A35   1A36   1EJ9   1K4S   1K4T   1LPQ   1NH3   1R49   1RR8   1RRJ   1SC7   1SEU   1T8I   1TL8  

 MGI Term (1)

Gene RIF (176)

PMID Text
27058666 TOP1 bound at promoters was discovered to become fully active only after pause-release. This transition coupled the phosphorylation of the carboxyl-terminal-domain (CTD) of RNA polymerase II (RNAPII) with stimulation of TOP1 above its basal rate, enhancing its processivity.
26801902 We found that the resistant cell lines showed 7-100 fold increased resistance to SN-38 but remained sensitive to docetaxel and the non-camptothecin Top1 inhibitor LMP400
26676887 the highest expression of GGH and EGFR was noted in the left-sided colon; the highest expression of DHFR, FPGS, TOP1 and ERCC1 was noted in the rectosigmoid, whereas TYMP expression was approximately equivalent in the right-sided colon and rectum
26578593 Data show that inhibition of DNA-dependent protein kinase catalytic subunit (DNA-PK) prevents type I DNA topoisomerase (Top1) degradation and proteasome activity in camptothecin (CPT)-treated quiescent WI38 cells.
26540186 NO-induced down-regulation of topoisomerase I protein.
26351326 Data show that the single-molecule supercoil relaxation assay is a sensitive method to elucidate the detailed mechanisms of type IB topoisomerase (Top1) inhibitors and is relevant for the cellular efficacy of Top1 inhibitors.
26314374 CCR6 SNPs are a risk factor for presence of anti-topoisomerase I antibodies in systemic sclerosis.
26221582 b-ELE could inhibit the proliferation of HepG-2 cells and interfere with the expression and activity of TOPO I and TOPO IIa
26025908 ERCC1-XPF participates in DNA repair of the Top1-DNA damage complex.
25987486 both TOP1 and TDP1 were upregulated in the tumor tissue compared to the adjacent non-tumor tissue in non-small cell lung cancer tissue
More...

AA Sequence

MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHK      1 - 70
DGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPR     71 - 140
DEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEER    141 - 210
YPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFK    211 - 280
DWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERI    281 - 350
ANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENI    351 - 420
QGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAG    421 - 490
NEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQP    491 - 560
EDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILC    561 - 630
NHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMK    631 - 700
LEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF         701 - 765
//

Text Mined References (247)

PMID Year Title
27058666 2016 RNA Polymerase II Regulates Topoisomerase 1 Activity to Favor Efficient Transcription.
26801902 2016 Molecular characterization of irinotecan (SN-38) resistant human breast cancer cell lines.
26676887 2016 Association between mRNA expression of chemotherapy-related genes and clinicopathological features in colorectal cancer: A large-scale population analysis.
26578593 2016 DNA-PK triggers histone ubiquitination and signaling in response to DNA double-strand breaks produced during the repair of transcription-blocking topoisomerase I lesions.
26540186 2015 Nitric Oxide Down-Regulates Topoisomerase I and Induces Camptothecin Resistance in Human Breast MCF-7 Tumor Cells.
26351326 2015 Single-Molecule Supercoil Relaxation Assay as a Screening Tool to Determine the Mechanism and Efficacy of Human Topoisomerase IB Inhibitors.
26314374 Confirmation of CCR6 as a risk factor for anti-topoisomerase I antibodies in systemic sclerosis.
26221582 2015 ?-Elemene Inhibits Cell Proliferation by Regulating the Expression and Activity of Topoisomerases I and II? in Human Hepatocarcinoma HepG-2 Cells.
26025908 2015 Repair synthesis step involving ERCC1-XPF participates in DNA repair of the Top1-DNA damage complex.
25987486 2015 Correlation between topoisomerase I and tyrosyl-DNA phosphodiesterase 1 activities in non-small cell lung cancer tissue.
More...