Property Summary

NCBI Gene PubMed Count 95
PubMed Score 101.35
PubTator Score 610.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Medium chain acyl-CoA dehydrogenase deficiency 13 6.997 3.5

Expression

  Differential Expression (7)

Disease log2 FC p
chronic lymphosyte leukemia 1.100 3.6e-04
limb girdle muscular dystrophy 2A -1.043 6.8e-04
ovarian cancer -1.700 4.4e-04
pancreatic ductal adenocarcinoma liver m... -1.769 3.3e-03
psoriasis 1.700 6.5e-04
ulcerative colitis -1.500 3.1e-07
Waldenstrons macroglobulinemia 1.759 4.4e-03

 GWAS Trait (1)

Gene RIF (50)

AA Sequence

MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKT      1 - 70
GEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQ     71 - 140
QKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLLARSDPD    141 - 210
PKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKT    211 - 280
RPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRN    281 - 350
TYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYK    351 - 420
N//

Text Mined References (104)

PMID Year Title