Property Summary

NCBI Gene PubMed Count 176
Grant Count 186
R01 Count 83
Funding $42,310,570.77
PubMed Score 700.51
PubTator Score 475.30

Knowledge Summary

Patent (56,710)

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.022
pancreatic cancer 1.100 0.001
malignant mesothelioma 1.500 0.000
esophageal adenocarcinoma -1.300 0.023
osteosarcoma -2.029 0.000
cystic fibrosis -1.163 0.000
atypical teratoid/rhabdoid tumor 1.200 0.000
lung cancer -1.200 0.000
pancreatic carcinoma 1.100 0.001
lung carcinoma -1.300 0.000
ovarian cancer 1.400 0.002
Breast cancer 1.400 0.000

Synonym

Accession P11309 Q38RT9 Q5T7H7 Q96RG3
Symbols PIM

Gene

PDB

1XQZ   1XR1   1XWS   1YHS   1YI3   1YI4   1YWV   1YXS   1YXT   1YXU   1YXV   1YXX   2BIK   2BIL   2BZH   2BZI   2BZJ   2BZK   2C3I   2J2I   2O3P   2O63   2O64   2O65   2OBJ   2OI4   2XIX   2XIY   2XIZ   2XJ0   2XJ1   2XJ2   3A99   3BGP   3BGQ   3BGZ   3BWF   3C4E   3CXW   3CY2   3CY3   3DCV   3F2A   3JPV   3JXW   3JY0   3JYA   3MA3   3QF9   3R00   3R01   3R02   3R04   3T9I   3UIX   3UMW   3UMX   3VBQ   3VBT   3VBV   3VBW   3VBX   3VBY   3VC4   3WE8   4A7C   4ALU   4ALV   4ALW   4AS0   4BZN   4BZO   4DTK   4ENX   4ENY   4GW8   4I41   4IAA   4JX3   4JX7   4K0Y   4K18   4K1B   4LL5   4LM5   4LMU   4MBI   4MBL   4MED   4MTA   4N6Y   4N6Z   4N70   4RBL   4RC2   4RC3   4RC4   4RPV   4TY1   4WRS   4WSY   4WT6   4XH6   4XHK   5C1Q   5DGZ   5DHJ   5DIA   5DWR   5EOL   5IIS   5IPJ  

  TechDev Info (1)

Michael McManus Genetic interaction screen

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (150)

PMID Text
26934497 glycogen synthase kinase 3 beta (GSK3B) and the forkhead box P3 (FOXP3) transcription factors are direct PIM1 targets.
26598507 demonstrate Pim1 as a novel kinase that is responsible for the phosphorylation of eNOS at Ser-633 and enhances endothelial cells sprouting of aortic rings from diabetic mice
26555723 By associating with PIM-1L, CD180 can thus obtain autonomous signaling capabilities, and this complex is then channeling inflammatory signals into B cell survival programs
26551340 A high percentage of urothelial carcinomas express Pim kinases. Pim expression differs in NILG, NIHG, and IHG lesions.
26472029 Data suggest that combining PIM and JAK2 kinase inhibitors may offer a more efficacious therapeutic approach for myeloproliferative neoplasms (MPNs) over JAK2 inhibitor mono-therapy.
26453516 Pim1 kinase activity maintains airway epithelial integrity and protects against house dust mite-induced proinflammatory activation of the airway epithelium.
26352175 Downregulation of microRNA33a promotes the expression CDK6, CCND1, and PIM1, and gastric cancer cell proliferation.
26202252 Pim kinase may represent a new host factor for HCV entry. Pim1 is an oncogenic serine/threonine kinase. HCV NS5A protein physically interacts with Pim1 and contributes to Pim1 protein stability.
26075720 Pim-1 and Pim-3 enhance phosphorylation and cell surface expression of CXCR4 in prostate cancer cells. PC-3 prostate cancer cells overexpressing either Pim-1 or Pim-3 kinases form larger xenograft tumors than the parental PC-3 cells.
25882843 Pim1 function depends upon intracellular localization in human cardiac progenitor cells
More...

AA Sequence

MPHEPHEPLTPPFSALPDPAGAPSRRQSRQRPQLSSDSPSAFRASRSHSRNATRSHSHSHSPRHSLRHSP      1 - 70
GSGSCGSSSGHRPCADILEVGMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGF     71 - 140
GSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLI    141 - 210
LERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGS    211 - 280
GALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRV    281 - 350
SSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK                    351 - 404
//

Text Mined References (181)

PMID Year Title
26934497 2016 The PIM1 kinase promotes prostate cancer cell migration and adhesion via multiple signalling pathways.
26598507 2016 Pim1 kinase promotes angiogenesis through phosphorylation of endothelial nitric oxide synthase at Ser-633.
26555723 2015 Human CD180 Transmits Signals via the PIM-1L Kinase.
26551340 Patterns and Significance of PIM Kinases in Urothelial Carcinoma.
26472029 2015 The PIM inhibitor AZD1208 synergizes with ruxolitinib to induce apoptosis of ruxolitinib sensitive and resistant JAK2-V617F-driven cells and inhibit colony formation of primary MPN cells.
26453516 2015 Pim1 kinase activity preserves airway epithelial integrity upon house dust mite exposure.
26352175 2015 Downregulation of microRNA?33a promotes cyclin?dependent kinase 6, cyclin D1 and PIM1 expression and gastric cancer cell proliferation.
26202252 2015 Pim Kinase Interacts with Nonstructural 5A Protein and Regulates Hepatitis C Virus Entry.
26075720 2015 Pim Kinases Promote Migration and Metastatic Growth of Prostate Cancer Xenografts.
25882843 2015 Functional Effect of Pim1 Depends upon Intracellular Localization in Human Cardiac Progenitor Cells.
More...