Property Summary

NCBI Gene PubMed Count 79
PubMed Score 817.34
PubTator Score 468.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy 1.276 1.2e-07
astrocytoma 2.500 1.2e-02
Astrocytoma, Pilocytic 1.300 1.1e-02
atypical teratoid/rhabdoid tumor 1.100 3.0e-02
autosomal dominant Emery-Dreifuss muscul... 1.158 2.0e-03
Becker muscular dystrophy 1.133 6.9e-05
Breast cancer 2.700 2.9e-02
dermatomyositis -1.200 1.8e-03
Down syndrome 1.100 6.7e-03
Duchenne muscular dystrophy 1.165 1.3e-08
ependymoma 1.600 2.0e-05
gastric cancer -1.400 1.4e-02
juvenile dermatomyositis 1.202 2.7e-10
limb girdle muscular dystrophy 2A 1.082 3.1e-07
lung adenocarcinoma 1.314 1.5e-04
Multiple myeloma 2.298 8.2e-04
osteosarcoma 2.896 1.3e-06
ovarian cancer -1.500 3.8e-03
pancreatic cancer -1.300 3.7e-02
pancreatic carcinoma -1.300 3.7e-02
psoriasis 2.000 1.0e-03
Waldenstrons macroglobulinemia 1.486 1.8e-02

Gene RIF (75)

AA Sequence

MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSD      1 - 70
ATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVE     71 - 140
SITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSP    141 - 210
SPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHS    211 - 280
EGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAF    281 - 350
SVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI       351 - 417
//

Text Mined References (87)

PMID Year Title