Property Summary

NCBI Gene PubMed Count 73
Grant Count 117
R01 Count 57
Funding $11,358,368.12
PubMed Score 751.61
PubTator Score 468.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Synonym

Accession P11279 B4DWL3 Q8WU33 Q96I40 Q9BRD2 Q9NP13 LAMP-1
Symbols LAMPA
CD107a
LGP120

Gene

Gene RIF (76)

PMID Text
26849049 The data support a viral entry mechanism dependent on binding to the lysosome-resident receptor LAMP1 and further dissociation of the membrane-distal GP1 subunits.
26186441 HIV-1 MA (p17) colocalizes with LAMP1 (lysosomal targeting) in the absense of Vpr in monocyte-derived macrophages
26186441 HIV-1 MA (p17) colocalizes with LAMP1 (lysosomal targeting) in the absense of Vpr in monocyte-derived macrophages
25972533 A unique triad of histidines of Lassa Virus GP1 forms a binding site for host LAMP1.
25915798 HIV-1 MA (p17) colocalizes with LAMP1 (lysosomal targeting) in the absense of Vpr in monocyte-derived macrophages
25760631 HIV-1 MA (p17) colocalizes with LAMP1 (lysosomal targeting) in the absense of Vpr in monocyte-derived macrophages
25396265 HIV-1 MA (p17) colocalizes with LAMP1 (lysosomal targeting) in the absense of Vpr in monocyte-derived macrophages
25376024 HIV-1 MA (p17) colocalizes with LAMP1 (lysosomal targeting) in the absense of Vpr in monocyte-derived macrophages
25360760 HIV-1 MA (p17) colocalizes with LAMP1 (lysosomal targeting) in the absense of Vpr in monocyte-derived macrophages
25320293 HIV-1 MA (p17) colocalizes with LAMP1 (lysosomal targeting) in the absense of Vpr in monocyte-derived macrophages
More...

AA Sequence

MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSD      1 - 70
ATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVE     71 - 140
SITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSP    141 - 210
SPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHS    211 - 280
EGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAF    281 - 350
SVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI       351 - 417
//

Text Mined References (81)

PMID Year Title
26849049 2016 Acidic pH-Induced Conformations and LAMP1 Binding of the Lassa Virus Glycoprotein Spike.
25972533 2015 Molecular Mechanism for LAMP1 Recognition by Lassa Virus.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25251993 2014 miR-184 regulates ezrin, LAMP-1 expression, affects phagocytosis in human retinal pigment epithelium and is downregulated in age-related macular degeneration.
25063738 2014 Epigenetic silencing of microRNA-373 to epithelial-mesenchymal transition in non-small cell lung cancer through IRAK2 and LAMP1 axes.
24970085 2014 Virus entry. Lassa virus entry requires a trigger-induced receptor switch.
24916509 2014 Synergistic defects of different molecules in the cytotoxic pathway lead to clinical familial hemophagocytic lymphohistiocytosis.
24695761 2014 Constitutive expression of a COOH-terminal leucine mutant of lysosome-associated membrane protein-1 causes its exclusive localization in low density intracellular vesicles.
24334114 2014 Lysosome-associated protein 1 (LAMP-1) and lysosome-associated protein 2 (LAMP-2) in a larger family carrier of Fabry disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...