Property Summary

NCBI Gene PubMed Count 336
Grant Count 250
R01 Count 96
Funding $80,827,209.79
PubMed Score 896.05
PubTator Score 560.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession P11274 P78501 Q12842 Q4LE80 Q6NZI3
Symbols ALL
CML
PHL
BCR1
D22S11
D22S662

Gene

BCR

PDB

1K1F   2AIN  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652149 confirmatory 0 / 0 / 47 Biochemical RhoGAP selectivity assay - BCR GAP

Gene RIF (257)

PMID Text
27273956 BCR-ABL1 transcript types found in Syria were similar to that of Indian Far-Eastern, African or European populations. The M-BCR rearrangement types were not dependent on white blood count, platelet count, hemoglobin level or gender of the patients.
26831735 Data suggest elevated interleukin-1beta secretion from tyrosine kinase inhibitor- (TKI-)resistant chronic myeloid leukemia (CML) cells contributes to TKI/imatinib resistance via promotion of cell viability/migration; cells used lack BCR-ABL mutation.
26721204 Blockade of the interaction between Bcr-Abl and PTB1B by small molecule SBF-1 to overcomes imatinib-resistance of K562 cells.
26607903 Suggest that AIC-47 in combination with imatinib strengthened the attack on cancer energy metabolism in BCR-ABL-harboring leukemic cells.
26429162 analysis of WT1 and M-BCR-ABL expressions in chronic myeloid leukemia reveals that high WT1 expression in CML patients is detected especially in the advanced stages of the disease
26295305 Identify a novel BCR-ABL/IkappaBalpha/p53 network, whereby BCR-ABL functionally inactivates a key tumor suppressor in chronic myeloid leukemia.
26291129 demonstrated that depletion of endogenous MAPK15 expression inhibited BCR-ABL1-dependent cell proliferation
26264145 Higher incidence of BCR-ABL and lower incidence of TEL-AML1 are associated with acute lymphoblastic leukemia.
26252834 Molecular rearrangements and the minimal residual disease follow-up for 5 chronic myeloid leukaemia patients; 3 resulted from new rearrangements between the BCR and ABL1 sequences (the breakpoints being located within BCR exon 13 in 2 cases and within BCR exon 18 in one case). The other 2 cases revealed a complex e8-[ins]-a2 fusion transcript involving a 3rd partner gene.
26186983 Data sugget that the acquisition of additional BCR-ABL1 fusion genes in chronic myeloid leukemia (CML) in the blast phase (BP) through mitotic recombination between the derivative chromosome and the normal homologue.
More...

AA Sequence

MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSY      1 - 70
DRQRWGFRRAAQAPDGASEPRASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASG     71 - 140
ERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGSQAMQM    141 - 210
ERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQ    211 - 280
SIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQS    281 - 350
SRVSPSPTTYRMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEG    351 - 420
AFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASEL    421 - 490
DLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEF    491 - 560
YDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA    561 - 630
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMT    631 - 700
VKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDEL    701 - 770
EAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRN    771 - 840
GKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLY    841 - 910
GFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNEEFEIELEGSQTLRILCYEKC    911 - 980
YNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTG    981 - 1050
VFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMD   1051 - 1120
VNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVA   1121 - 1190
EKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDS   1191 - 1260
KRQSILFSTEV                                                              1261 - 1271
//

Text Mined References (347)

PMID Year Title
27273956 Correlation of p210 BCR-ABL transcript variants with clinical, parameters and disease outcome in 45 chronic myeloid leukemia patients.
26831735 2016 Secretion of IL-1? from imatinib-resistant chronic myeloid leukemia cells contributes to BCR-ABL mutation-independent imatinib resistance.
26721204 2016 Blockade of the interaction between Bcr-Abl and PTB1B by small molecule SBF-1 to overcome imatinib-resistance of chronic myeloid leukemia cells.
26607903 2016 Perturbation of energy metabolism by fatty-acid derivative AIC-47 and imatinib in BCR-ABL-harboring leukemic cells.
26429162 2015 Real-time quantitative PCR detection of WT1 and M-BCR-ABL expressions in chronic myeloid leukemia.
26295305 2015 Non genomic loss of function of tumor suppressors in CML: BCR-ABL promotes I?B? mediated p53 nuclear exclusion.
26291129 2015 MAPK15 mediates BCR-ABL1-induced autophagy and regulates oncogene-dependent cell proliferation and tumor formation.
26264145 2015 Prevalence of common fusion transcripts in acute lymphoblastic leukemia: A report of 304 cases.
26252834 2015 Molecular characterization and follow-up of five CML patients with new BCR-ABL1 fusion transcripts.
26186983 Cytogenetic, fluorescence in situ hybridization, and genomic array characterization of chronic myeloid leukemia with cryptic BCR-ABL1 fusions.
More...