Property Summary

NCBI Gene PubMed Count 627
Grant Count 177
R01 Count 62
Funding $29,274,925.1
PubMed Score 546.94
PubTator Score 1136.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -3.200 0.000
posterior fossa group B ependymoma 1.400 0.000
pancreatic ductal adenocarcinoma liver m... -1.987 0.004
spina bifida -1.644 0.036
ulcerative colitis -1.600 0.000
psoriasis -2.000 0.000

Gene

PANTHER Protein Class (2)

PDB

2PFR  

Gene RIF (735)

PMID Text
26683305 Findings support a role for NAT2 in modifying the association between red meat consumption and colorectal cancer in Japanese and African Americans.
26681215 the NAT2 slow acetylation genotypes might increase the susceptibility to pancreatic cancer in Europe but that these have no significant effects in the United States and multi-center populations.
26681036 NAT2 slow acetylation state was associated with bladder cancer risk, and was shown to modestly increase the risk of bladder cancer.
26656326 TT genotype in NAT2 C282T polymorphism may be a risk factor for lung cancer susceptibility. Additionally, the acetylator status of 5 SNPs in NAT2 gene may not be associated with lung cancer risk (Meta-Analysis)
26641831 Findings suggest that variations in the NAT2 gene and their interactions contribute to occupational diisocyanate asthma susceptibility.
26620671 The pattern of variation of NAT2 in sub-Saharan African food-producing populations differs from that expected under a model of isolation-by-distance or from those observed with other genetic systems, but it is compatible with the hypothesis that it was shaped by selective pressures linked to the chemical environment in which populations evolved.
26616266 Individuals with NAT2 slow acetylators may have increased risk of antituberculosis drug-induced liver injury when standard dose of isoniazid was used. [META-ANALYSIS]
26615528 The results suggest that NAT2 is related to cognitive processes dealing with distraction and attentional control in the auditory modality; ultra-slow acetylation status was associated with reduced higher cognitive functions
26409796 The rs1799931(G>A) genotype was detected in the control population but not in the T2DM population. The wild type (G) allele frequency was higher in T2DM than controls. The mutant allele (A) in rs1799931(G>A) had a protective effect for T2DM.
26204535 Transmission disequilibrium showed a positive association between allele *5 and non-syndromic Cleft lip with or without cleft palate (odds ratio = 1,6; p = 0,03).
More...

AA Sequence

MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQ      1 - 70
VNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISG     71 - 140
KDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQ    141 - 210
TSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLV    211 - 280
PKPGDGSLTI                                                                281 - 290
//

Text Mined References (628)

PMID Year Title
26683305 2015 Interaction between Red Meat Intake and NAT2 Genotype in Increasing the Risk of Colorectal Cancer in Japanese and African Americans.
26681215 2015 Association between N-acetyltransferase 2 polymorphisms and pancreatic cancer risk: a meta-analysis.
26681036 2015 Meta-analysis of the relationship between slow acetylation of N-acetyl transferase 2 and the risk of bladder cancer.
26656326 2015 Association Between NAT2 Polymorphisms and Lung Cancer Susceptibility.
26641831 2015 N-Acetyltransferase 2 Genotypes Are Associated With Diisocyanate-Induced Asthma.
26620671 2015 Variation in NAT2 acetylation phenotypes is associated with differences in food-producing subsistence modes and ecoregions in Africa.
26616266 2015 Susceptibility of N-acetyltransferase 2 slow acetylators to antituberculosis drug-induced liver injury: a meta-analysis.
26615528 2015 The ultra-slow NAT2*6A haplotype is associated with reduced higher cognitive functions in an elderly study group.
26409796 N-acetyltransferase 1 and 2 polymorphisms and risk of diabetes mellitus type 2 in a Saudi population.
26204535 2015 [Association between NAT2 polymorphisms with non-syndromic cleft lip with or without cleft palate in Argentina].
More...