Property Summary

NCBI Gene PubMed Count 657
PubMed Score 569.04
PubTator Score 1136.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -3.200 2.3e-08
ependymoma 1.100 7.4e-04
pancreatic ductal adenocarcinoma liver m... -1.987 3.7e-03
psoriasis -2.000 5.5e-10
spina bifida -1.644 3.6e-02
ulcerative colitis -1.600 2.9e-05

 OMIM Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (765)

AA Sequence

MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQ      1 - 70
VNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISG     71 - 140
KDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQ    141 - 210
TSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLV    211 - 280
PKPGDGSLTI                                                                281 - 290
//

Text Mined References (658)

PMID Year Title