Property Summary

NCBI Gene PubMed Count 48
PubMed Score 50.92
PubTator Score 46.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 3.288 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.300 9.7e-03
ependymoma -1.100 4.3e-02
group 3 medulloblastoma -1.100 1.1e-02
malignant mesothelioma -1.100 5.4e-05
medulloblastoma, large-cell -1.700 2.5e-04
osteosarcoma 2.549 3.5e-07
psoriasis 1.400 1.8e-03
Rheumatoid arthritis -1.400 1.3e-02

 IMPC Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (33)

AA Sequence

MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA      1 - 70
GQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPV     71 - 140
EEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL        141 - 206
//

Text Mined References (53)

PMID Year Title