Property Summary

NCBI Gene PubMed Count 44
Grant Count 68
R01 Count 54
Funding $4,290,731.98
PubMed Score 49.70
PubTator Score 46.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis -1.400 0.013
malignant mesothelioma -1.100 0.000
astrocytic glioma -1.300 0.010
ependymoma -1.100 0.043
psoriasis 2.600 0.000
osteosarcoma 2.549 0.000
medulloblastoma, large-cell -1.700 0.000
group 4 medulloblastoma -1.300 0.000

Synonym

Accession P11234 B4E040 Q53T32 Q6ZS74
Symbols

Gene

PDB

2KE5   2KWI  

Gene RIF (30)

PMID Text
26216878 striking isoform-specific consequences of distinct CAAX-signaled posttranslational modifications that contribute to the divergent subcellular localization and activity of RalA and RalB.
25573158 These findings suggest that RalB might be one of the targets for facilitating the invasive phenotype of malignant gliomas induced by GGTase-I.
25210032 expression of K-Ras and RalB and possibly RalA proteins is critical for maintaining low levels of p53, and down-regulation of these GTPases reactivates p53 by significantly enhancing its stability, contributing to suppression of malignant transformation
24747441 Integrin alpha(v)beta expression and the resulting KRAS-RalB-NF-kappaB pathway were both necessary and sufficient for tumour initiation, anchorage independence, self-renewal and erlotinib resistance.
24389431 High RALB mRNA expression is associated with non-small-cell lung cancer growth and progression.
24056301 nutrient starvation induces RALB deubiquitylation by accumulation and relocalization of the deubiquitylase USP33 to RALB-positive vesicles
23830877 RalA and RalB exhibit both distinct and redundant roles in tumorigenesis (Review).
22790202 The study found upregulated RalA and RalB activation in colorectal cancer tumor cell lines and tumors.
22700969 the existence of an ubiquitination/de-ubiquitination cycle superimposed on the GDP/GTP cycle of RalA, involved in the regulation of RalA activity as well as in membrane raft trafficking.
22393054 phosphorylation by PKCalpha is critical for RalB-mediated vesicle trafficking and exocytosis.
More...

AA Sequence

MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA      1 - 70
GQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPV     71 - 140
EEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL        141 - 206
//

Text Mined References (49)

PMID Year Title
26216878 2015 Divergent roles of CAAX motif-signaled posttranslational modifications in the regulation and subcellular localization of Ral GTPases.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25573158 2015 Involvement of RalB in the effect of geranylgeranyltransferase I on glioma cell migration and invasion.
25210032 2014 Ral GTPase down-regulation stabilizes and reactivates p53 to inhibit malignant transformation.
24747441 2014 An integrin ??-KRAS-RalB complex drives tumour stemness and resistance to EGFR inhibition.
24389431 2013 Contributions of KRAS and RAL in non-small-cell lung cancer growth and progression.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23830877 2013 Ral GTPases in tumorigenesis: emerging from the shadows.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...