Property Summary

NCBI Gene PubMed Count 93
Grant Count 143
R01 Count 105
Funding $9,646,035.21
PubMed Score 159.20
PubTator Score 263.28

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P11233 A4D1W3
Symbols RAL

Gene

PDB

1UAD   1ZC3   1ZC4   2A78   2A9K   2BOV  

Gene RIF (50)

PMID Text
26477566 agonist-induced Gbetagamma-mediated conversion of RalA from the GTP-bound form to the GDP-bound form could be a mechanism to facilitate agonist-induced internalization of GPCRs.
26216878 striking isoform-specific consequences of distinct CAAX-signaled posttranslational modifications that contribute to the divergent subcellular localization and activity of RalA and RalB.
26205497 RalA activation was remarkably impaired in rac1-deficient skeletal muscle fibres.
26158537 RCC2 exhibits guanine exchange factor activity, in vitro and in cells, for the small GTPase RalA. RCC2 and RalA apparently work together to contribute to the regulation of kinetochore-microtubule interactions in early mitosis.
25210032 expression of K-Ras and RalB and possibly RalA proteins is critical for maintaining low levels of p53, and down-regulation of these GTPases reactivates p53 by significantly enhancing its stability, contributing to suppression of malignant transformation
24222664 These results indicate that MLN8237 treatment may be effective for a subset of patients with PDAC independent of RalA S194 phosphorylation
24063364 microRNA-140 targets RALA and regulates chondrogenic differentiation of human mesenchymal stem cells by translational enhancement of SOX9 and ACAN.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of v-ral simian leukemia viral oncogene homolog A (RALA) expression by HIV-1 Vpr in Vpr transduced macrophages
23830877 RalA and RalB exhibit both distinct and redundant roles in tumorigenesis (Review).
23770673 Data show that small GTPase RALA regulates formation of a JIP1 (C-Jun-amino-terminal-interacting protein 1) scaffold complex to propagate JNK signaling toward FOXO4 (forkhead box O transcription factor) in response to reactive oxygen species (ROS).
More...

AA Sequence

MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA      1 - 70
GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVE     71 - 140
EAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL        141 - 206
//

Text Mined References (96)

PMID Year Title
26477566 2016 Agonist-induced changes in RalA activities allows the prediction of the endocytosis of G protein-coupled receptors.
26216878 2015 Divergent roles of CAAX motif-signaled posttranslational modifications in the regulation and subcellular localization of Ral GTPases.
26205497 2015 Role for RalA downstream of Rac1 in skeletal muscle insulin signalling.
26158537 2015 TD-60 links RalA GTPase function to the CPC in mitosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25210032 2014 Ral GTPase down-regulation stabilizes and reactivates p53 to inhibit malignant transformation.
24222664 2014 Response to MLN8237 in pancreatic cancer is not dependent on RalA phosphorylation.
24063364 2014 microRNA-140 targets RALA and regulates chondrogenic differentiation of human mesenchymal stem cells by translational enhancement of SOX9 and ACAN.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23830877 2013 Ral GTPases in tumorigenesis: emerging from the shadows.
More...