Property Summary

NCBI Gene PubMed Count 101
PubMed Score 169.89
PubTator Score 263.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.400 1.2e-03
atypical teratoid / rhabdoid tumor 1.300 5.8e-04
diabetes mellitus -1.100 2.4e-03
glioblastoma 1.300 2.1e-05
group 4 medulloblastoma 1.200 6.3e-04
intraductal papillary-mucinous carcinoma... 1.100 4.0e-04
intraductal papillary-mucinous neoplasm ... 1.400 2.4e-03
medulloblastoma, large-cell 1.200 1.7e-03
osteosarcoma 1.131 1.1e-02
ovarian cancer 3.600 3.8e-08
pancreatic cancer 1.200 3.8e-05
primitive neuroectodermal tumor 1.300 4.5e-04
psoriasis 1.100 1.9e-04
subependymal giant cell astrocytoma 1.557 6.7e-03
tuberculosis -1.900 1.6e-07

Protein-protein Interaction (2)

Gene RIF (56)

AA Sequence

MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA      1 - 70
GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVE     71 - 140
EAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL        141 - 206
//

Text Mined References (105)

PMID Year Title