Property Summary

Ligand Count 13
NCBI Gene PubMed Count 27
PubMed Score 17.86
PubTator Score 24.85

Knowledge Summary

Patent (1,362)

TINX Plot

  Disease (7)

Disease Target Count P-value
malignant mesothelioma 3232 1.4e-06
cystic fibrosis 1696 3.7e-04
Disease Target Count Z-score Confidence
Congenital myasthenic syndrome 25 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
cystic fibrosis -1.068 3.7e-04
malignant mesothelioma 1.500 1.4e-06

 MGI Phenotype (1)

Gene RIF (17)

AA Sequence

MTPGALLMLLGALGAPLAPGVRGSEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLILAQLISLNEKD      1 - 70
EEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNNDGNFDVALDISVVVSSDGSVR     71 - 140
WQPPGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLQTGLGPDGQGHQEIHIHEGTFIENGQWEI    141 - 210
IHKPSRLIQPPGDPRGGREGQRQEVIFYLIIRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLS    211 - 280
IFALLTLTVFLLLLADKVPETSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIF    281 - 350
IHKLPLYLRLKRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFI    351 - 420
DGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTSVGTLVIFLDA    421 - 490
TYHLPPPDPFP                                                               491 - 501
//

Text Mined References (29)

PMID Year Title