Property Summary

NCBI Gene PubMed Count 679
Grant Count 157
R01 Count 68
Funding $27,520,064.58
PubMed Score 478.60
PubTator Score 1667.73

Knowledge Summary

Patent

No data available

Synonym

Accession P11226 Q4VB12 Q4VB13 Q4VB14 Q5SQS3 Q86SI4 Q96KE4 Q96TF7 Q96TF8 Q96TF9 MBP-C
Symbols MBL
MBP
MBP1
MBPD
MBL2D
MBP-C
COLEC1
HSMBPC

Gene

PANTHER Protein Class (1)

PDB

1HUP  

Gene RIF (807)

PMID Text
26823854 Variant A allele in MBL2 gene rs1800450 polymorphism might increase the risk of sepsis via decrease the MBL serum level
26810288 Our meta-analysis of accessible, published data has demonstrated no statistically significant association between MBL2 genotype and recurrent respiratory tract infection in children.
26745156 These findings suggest a protective effect of genetically determined MBL2 deficiency against the development and progression of chronic Chagas cardiomyopathy.
26684757 MBL2 haplotype is associated with frequent exacerbations and high serum MBL is linked to increased survival in COPD patients.
26613217 MBL gene codon 54 variant allele B is related to low serum MBL levels, increased IL-6 levels, genitourinary infections and may cause pregnancy-related problems such as infertility, recurrent miscarriage and preterm delivery
26608926 The results of the meta-analysis evidenced that MBL2 low producing OO and XX genotypes do not confer higher risk to rheumatoid arthritis
26603976 Human and murine data together indicate that SP-A, SP-D and MBL are synthesized in early gestational tissues, and may contribute to regulation of immune response at the feto-maternal interface during pregnancy.
26506729 YB haplotype is associated with low serum levels of mannose-binding lectin (MBL). There was no association between MBL2 gene polymorphisms and susceptibility to dengue infection but the frequency of YB was higher in patients than in controls.
26433879 Polymorphisms of the MBL2 gene is associated with fever episodes in pediatric cancer.
26429318 Frequent IgG subclass and mannose binding lectin deficiency has been found in patients with chronic fatigue syndrome.
More...

AA Sequence

MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQ      1 - 70
GPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFL     71 - 140
TNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNE    141 - 210
GEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI                                    211 - 248
//

Text Mined References (684)

PMID Year Title
26823854 2015 The role of MBL2 gene polymorphism in sepsis incidence.
26810288 2016 Mannose binding lectin codon 54 polymorphism and susceptibility to recurrent respiratory tract infections in children: A meta-analysis.
26745156 2016 Genetically Determined MBL Deficiency Is Associated with Protection against Chronic Cardiomyopathy in Chagas Disease.
26684757 2015 Mannose-binding lectin protein and its association to clinical outcomes in COPD: a longitudinal study.
26613217 Mannose-binding lectin may affect pregnancy outcome.
26608926 2016 Mannose-binding lectin polymorphisms and rheumatoid arthritis: A short review and meta-analysis.
26603976 2016 Expression and localization of collectins in feto-maternal tissues of human first trimester spontaneous abortion and abortion prone mouse model.
26506729 2015 ASSOCIATION BETWEEN MANNOSE-BINDING LECTIN GENE POLYMORPHISMS AND SUSCEPTIBILITY TO DENGUE VIRUS INFECTION: A PRELIMINARY REPORT.
26433879 2016 The role of mannose binding lectin on fever episodes in pediatric oncology patients.
26429318 2015 Frequent IgG subclass and mannose binding lectin deficiency in patients with chronic fatigue syndrome.
More...