Property Summary

NCBI Gene PubMed Count 28
PubMed Score 92.34
PubTator Score 174.69

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P11216 Q96AK1 Q9NPX8
Symbols GPBB

Gene

PANTHER Protein Class (2)

PDB

5IKO   5IKP  

Gene RIF (9)

PMID Text
22838188 H-FABP and GPBB can contribute to early acute myocardial infarction diagnosis and can distinguish acute myocardial infarction from acute coronary syndrome
22818785 GPBB is a valuable biological marker to predict the prognosis in patient with acute coronary syndrome.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20482380 Significant increase in plasma glycoprotein BB in patients with hypertrophic cardiomyopathy.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
17393985 Brain-type glycogen phosphorylase is expressed in non-small-cell lung carcinoma, particularly adenocarcinomas, and is an independent poor prognostic factor.

AA Sequence

MAKPLTDSEKRKQISVRGLAGLGDVAEVRKSFNRHLHFTLVKDRNVATPRDYFFALAHTVRDHLVGRWIR      1 - 70
TQQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDLEELEEIEEDAGLGNGGLGRL     71 - 140
AACFLDSMATLGLAAYGYGIRYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHT    141 - 210
PDGVKWLDTQVVLAMPYDTPVPGYKNNTVNTMRLWSAKAPNDFKLQDFNVGDYIEAVLDRNLAENISRVL    211 - 280
YPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTCFETFPDKVAIQLNDTHPALSIPEL    281 - 350
MRILVDVEKVDWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKLLPRHLEIIYAINQRHLDHVAALFP    351 - 420
GDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGVARIHSEIVKQSVFKDFYELEPEKFQNKTNGITPR    421 - 490
RWLLLCNPGLADTIVEKIGEEFLTDLSQLKKLLPLVSDEVFIRDVAKVKQENKLKFSAFLEKEYKVKINP    491 - 560
SSMFDVHVKRIHEYKRQLLNCLHVVTLYNRIKRDPAKAFVPRTVMIGGKAAPGYHMAKLIIKLVTSIGDV    561 - 630
VNHDPVVGDRLKVIFLENYRVSLAEKVIPAADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEM    631 - 700
AEEAGAENLFIFGLRVEDVEALDRKGYNAREYYDHLPELKQAVDQISSGFFSPKEPDCFKDIVNMLMHHD    701 - 770
RFKVFADYEAYMQCQAQVDQLYRNPKEWTKKVIRNIACSGKFSSDRTITEYAREIWGVEPSDLQIPPPNI    771 - 840
PRD                                                                       841 - 843
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22838188 2012 Diagnostic accuracy of heart fatty acid binding protein (H-FABP) and glycogen phosphorylase isoenzyme BB (GPBB) in diagnosis of acute myocardial infarction in patients with acute coronary syndrome.
22818785 2012 Prognostic information of glycogen phosphorylase isoenzyme BB in patients with suspected acute coronary syndrome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21269460 2011 Initial characterization of the human central proteome.
More...