Property Summary

NCBI Gene PubMed Count 262
PubMed Score 3795.92
PubTator Score 2004.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Connective tissue disease 59 0.0 2.0
systemic lupus erythematosus 172 0.0 2.0
Disease Target Count
SLEB6 1
Disease Target Count
Systemic lupus erythematosus 6 1

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 4.100 1.2e-07
cutaneous lupus erythematosus 1.600 2.0e-02
osteosarcoma -3.899 5.2e-05
astrocytoma 1.600 3.4e-02
group 3 medulloblastoma -1.700 1.4e-04
medulloblastoma, large-cell -1.200 2.1e-02
Duchenne muscular dystrophy 1.060 1.2e-06
adrenocortical carcinoma -1.802 1.9e-04
tuberculosis 2.000 9.1e-07
non-small cell lung cancer -1.238 4.4e-08
intraductal papillary-mucinous adenoma (... -1.600 2.1e-02
lung cancer -3.300 2.0e-06
interstitial cystitis 1.500 1.4e-03
subependymal giant cell astrocytoma 1.685 3.0e-02
invasive ductal carcinoma 1.713 1.2e-04
lung carcinoma -1.900 1.0e-21
mucosa-associated lymphoid tissue lympho... 2.090 1.9e-02
ulcerative colitis 1.600 9.1e-05
ovarian cancer -3.100 3.4e-09
head and neck cancer and chronic obstruc... 1.100 1.1e-03

Protein-protein Interaction (3)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1497 screening 501 / 0 / 92022 HTS identification of compounds inhibiting the binding of CD11b/CD18 to fibrinogen via a luminescence assay.
1499 screening 67 / 0 / 92623 HTS identification of compounds that enhance the binding of CD11b/CD18 to fibrinogen via a luminescence assay.
1644 summary 0 / 0 / 0 Summary of compounds inhibiting the binding of CD11b/CD18 to fibrinogen via a luminescence assay
1652 summary 0 / 0 / 0 Summary of compounds that enhance the binding of CD11b/CD18 to fibrinogen via a luminescence assay.

Gene RIF (225)

PMID Text
26852488 Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria
26512111 A novel expanding CD11b+ conventional dendritic cell subpopulation dominates the infiltrating renal inflammatory milieu, localizing to the glomeruli, in lupus nephritis.
26361072 While total surface expression of CD11b and L-selectin on neutrophils was largely unaffected
26309131 CD11b expression level might be considered a prognostic biomarker for Acute Myeloid Leukemia patients. [meta-analysis]
26306739 Data show that secreted aspartic protease 2 (Sap2) of Candida albicans inactivates human macrophage complement factor H (factor H), factor H-receptors CD11b/CD18 and CD11c/CD18.
26293614 There is direct interaction between C3(H2O) and CD11b. Contact-activated C3(H2O) is a novel ligand for CD11b/CD18 that mediates platelet-PMN complex formation and the binding of platelet-derived microparticles to PMNs.
26170143 study supports the crucial role of GABP in myeloid cell differentiation and identified ITGAM/CD11b as a novel GABP target gene
26036990 the results identify dynorphins A and B as novel ligands for Mac-1.
25971554 we confirmed the similarities between epithelial ovarian cancer and fallopian tube, normal and adenocarcinoma using FOLR1, FOLR2, CD68 and CD11b markers
25826119 analysis of neutrophil and monocyte expression of toll-like receptor 4, CD11b and reactive oxygen intermediates, and correlation with neuroimaging outcomes in preterm infants
25678086 A novel association of common variable immunodeficiency have been found with rare variants at the FUS/ITGAM (CD11b) locus on 16p11.2.
25655529 increased in neonates with abnormal neuroimaging and/or severe neonatal encephalopathy
25613106 newly revealed recognition specificity of alpha(M)beta2 toward unfolded protein segments and cationic proteins and peptides suggests that alpha(M)beta2 may serve as a previously proposed "alarmin" receptor with important roles in innate host defense
25554420 Examination of CR3 ( CD11b/CD18)mutant variants and mass spectrometry analysis of the N-glycosylation pattern of CR3 revealed that N-glycans located in the C-terminal part of the CD11b subunit are involved in binding and cytotoxic activity of CyaA.
25461401 Data indicate that Candida albicans beta-Glucan induces high IL-1 receptor antagonist (IL-1Ra) levels, independently from Dectin-1/complement receptor 3 (CR3).
25365491 role of CD11b/CD18 in priming of human leukocytes by endotoxin glycoforms from Escherichia coli
25315704 The rs1143679 polymorphism is associated with systemic lupus erythematosus susceptibility in different ethnic groups and with lupus nephritis in Europeans. No association was found with rheumatoid arthritis. [Meta-Analysis]
25305756 A new genome-wide significant association between ITGAM-ITGAX and IgA nephropathy.
25238263 Il-6-induced recruitment of CD11b+ CD14+ HLA-DR- myeloid-derived suppressor cells is associated with progression and poor prognosis in squamous cell carcinoma of the esophagus.
25231265 beta2 integrins-mediated chemosensory adhesion and migration of polymorphonuclear leukocytes on the vascular graft surface, bacterial cellulose.
25136078 A negative correlation was found between CD11b percentage and postinfarct left ventricular ejection fraction.
25024378 This suggests that FcgammaRIIIb signals in association with macrophage-1 Ag.
25005557 hnRNP K in PU.1-containing complexes recruited at the CD11b promoter: a distinct role in modulating granulocytic and monocytic differentiation of AML-derived cells.
24945596 The HNA-1b allotype influences the Fc gamma RIIIb cooperation with Fc gamma RIIa, but not with CR3.
24886912 Results show the functional importance of integrin alpha M (ITGAM) in systemic lupus erythematosus (SLE) pathogenesis through impaired phagocytosis.
24829201 circulating trisomy 12 CLL cells also have increased expression of the integrins CD11b, CD18, CD29, and ITGB7, and the adhesion molecule CD323.
24782118 Although CD11b was more frequently expressed in blast cells of patients with intermediate and unfavorable cytogenetic risk groups, this feature did not translate into different clinical outcome.
24726062 Complement receptor 3 (CR3) inhibition impairs phagocytosis of serum-opsonized zymosan but has little impact on phagocytosis of unopsonized zymosan in the absence or presence of lipopolysaccharide.
24608226 The transcript levels of ITGAM significantly decreased for the systemic lupus erythematosus risk allele (A) relative to the non-risk allele (G), in a dose-dependent fashion.
24269694 genetic polymorphism is associated with systemic lupus erythematosus in Brazilian patients
24264377 In vivo engagement of B cell receptors in CD11b-deficient mice leads to increased autoantibody production and kidney immunoglobulin (Ig) deposition, thereby maintaining autoreactive B cell tolerance.
23981064 Distribution of integrin beta(2) is also markedly altered in M. tuberculosis-infected DCs. A corresponding reduction in the alphaL (CD11a) and alphaM (CD11b) subunits that associate with integrin beta(2) was also observed.
23918739 The nonsynonymous ITGAM variants rs1143679 and rs1143678/rs113683 contribute to altered Mac-1 function on neutrophils.
23880611 PGE2 may be involved in regulation of CD11b expression on eosinophils by aspirin administration.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, alpha M (ITGAM, CR3A) expression by HIV-1 Vpr in Vpr transduced macrophages
23812215 Expression of CD11b and CD162 on monocytes has a temperature-dependent regulation, with decreased expression during hypothermia.
23754403 Staphylococcus aureus LukAB directly interacts with neutrophil CD11b by binding to the I domain, a property that determines the species specificity exhibited by this toxin.
23753600 studies of ITGAM genetic variants which are linked to systemic lupus erythematosus(SLE) have revealed that the R77H variant of the CD11b/Mac-1 receptor displays functional defects which may be relevant to SLE development
23727038 Rhinovirus colocalizes with CD68- and CD11b-positive macrophages following experimental infection in humans.
23720274 LPS-induced Mac-1 expression on monocytes was significantly inhibited by pre-treatment with U-75302, a BLT1-receptor antagonist, suggesting a pivotal role of 5-LO-derived leukotrienes stop
23708937 The altered expression levels of ITGAM and FCgammaRIIIA mRNA in systemic lupus erythematosus patients and their correlations with clinical data suggest that ITGAM and FCgammaRIIIA may play a role in this disease.
23686079 Hyperglycemic patients with type 2 diabetes have significantly higher levels of CD11b on granulocytes and monocytes compared to expression values of healthy controls.
23671673 The expression of CD11b, TLR4 and TLR2 is increased in monocyte-derived macrophages in IQ memory-discrepant individuals.
23573259 Coronary artery disease patients blood samples showed a significantly higher L-selectin, but not CD11b response to TLR stimulation than controls.
23514737 Binding kinetics differences between Mac-1 and lymphocyte function-associated antigen (LFA)-1 are quantified and insight provided into their distinct functions in the inflammatory cascade of activated neutrophils.
23479224 The progression of diapedesis may be regulated by spatial and temporal cleavage of Mac-1, which is triggered upon interaction with endothelium.
23469114 the 3D structure of the alphaA-containing ectodomain of the leukocyte integrin CD11b/CD18 (alphaMbeta2) in its inactive state
23452299 There was no difference in neutrophil or monocyte CD11b expression among 4 study groups (sepsis (S), septic shock (SS), traumatic brain injury (TBI), controls (C)). Lymphocyte CD11b showed lower values in SS compared to C and TBI or S.
23451151 findings demonstrate that the reduction in CR3-mediated phagocytosis associated with the 77H CD11b variant is not macrophage-restricted but demonstrable in other CR3-expressing professional phagocytic cells
23398146 Allele frequencies were determined in the blood donor population as follows: 0.318 for HNA-1a, 0.668 for HNA-1b, 0.014 for HNA-1c, 0.768 for HNA-3a, 0.232 for HNA-3b, 0.882 for HNA-4a, 0.118 for HNA-4b, 0.736 for HNA-5a and 0.264 for HNA-5b.
23334594 This study did not find an upregulation of CD11b in brain in patient with multiple sclerosis.
23269830 Motility assays and time-lapse video microscopy showed that pneumococcal stimulation of macrophage motility required RrgA and complement receptor 3.
23257917 integrin alpha9beta1/CD11B levels in circulating neutrophils are significantly elevated in pneumonia patients
23184931 macrophage interleukin-13 receptor has a role in foam cell formation through alphaMbeta2 integrin interference
23092917 CD11b expression correlates with monosomal karyotype and predicts an extremely poor prognosis in cytogenetically unfavorable acute myeloid leukemia.
22893614 CD11b suppressed induction of NFATc1 by the complementary mechanisms of downregulation of RANK expression and induction of recruitment of the transcriptional repressor B-cell lymphoma 6 (BCL6) to the NFATC1 gene.
22722613 The early signaling requirements for the CD11b/CD203c compartment expression and CD63 degranulation provide support for the hypothesis that CD11b and CD203c reside in a similar compartment.
22586164 The R77H variant of ITGAM impairs a broad range of CR3 effector functions in human monocytes and may predispose to systemic lupus erythematosus.
22552879 This study demonstrated regulation of alpha(M)-integrin on circulating mononuclear cells in Guillain-Barre syndrome (GBS), as well as an important role for alpha(M)-integrin-ICAM-1 interactions in pathogenic GBS patient leukocyte trafficking at the blood-nerve barrier in vitro
22251373 Data indicate the simultaneous analysis of CD64 together with CD304 (Neuropilin-1) or the combination of CD11b and CD38 was suitable for the identification of rheumatoid arthritis (RA)patients with high current activity in synovitis.
22229891 conclude that IL-8 is the major factor regulating the expression of CD11b activation epitope in neutrophils
22095715 Denticity of the Asp/Glu ligand of integrin CD11b/CD18 can modify divalent cation (calcium or magnesium) selectivity at the metal ion-dependent adhesion site in neutrophils, and hence integrin function.
22053606 Morbidly obese individuals had significantly increased levels CD11b expression on monocytes as compared to controls.
22052909 structures and interaction analyses of integrin alphaMbeta2 cytoplasmic tails
22017400 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, alpha M (ITGAM, CR3A) expression by HIV-1 Vpr in Vpr transduced macrophages
21874872 The data obtained suggest that spontaneous cell adhesion to fibrinogen is mediated to a greater extent by CD11b/CD18 integrins, while chemokine-stimulated adhesion and migration is mostly dependent on CD11c/CD18 molecules.
21840425 The aim of this study is to examine whether the ITGAM variant is also associated with other than systemic lupus erythematosus autoimmune diseases.
21676865 low density lipoprotein receptor-related protein 1 (LRP1) interacts with integrin alphaMbeta2 at specific binding sites
21610569 Data found that blocking CD11b, CD18, or CD54 on the endothelial progenitor cells (EPC) surface with monoclonal antibodies protected EPCs, enhancing its survival.
21571730 a potential influence of ITGAM rs1143679 in vascular lesion as part of pathophysiology of systemic sclerosis
21551251 PMN sialidase could be a physiologic source of the enzymatic activity that removes sialyl residues on beta2 integrin and ICAM-1, resulting in their enhanced interaction, and may be an important regulator of the recruitment of these cells to inflamed sites.
21454473 the systemic lupus erythematosus-associated R77H substitution in the CD11b chain of the Mac-1 integrin compromises leukocyte adhesion and phagocytosis
21403131 Kinetic studies showed that the cleavage of CD11b is positively correlated with PMN detachment and subsequent transmigration.
21362770 Two large cohorts of systemic sclerosis (SSc) patients of European Caucasian ancestry do not support the implication of ITGAM, ITGAX, and CD58 genes in the genetic susceptibility of SSc, although they were identified as autoimmune disease risk genes.
21273385 Mycobacterial hypersensitivity pneumonitis requires TLR9-MyD88 in lung CD11b+ CD11c+ cells
21263017 study shows that P. gingivalis activates Rac2 and Cdc42 and upregulates CD11b/CD18 and its high-affinity epitope on neutrophils
21252155 alphaMbeta integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.
21151989 Polymorphisms of the ITGAM gene confer higher risk of discoid cutaneous than of systemic lupus erythematosus in Swedish and Finnish populations
21135163 Involvement of CD11b/CD18 (Mac-1) in fibrin(ogen)-mediated melanoma-neutrophil aggregations is defined in a study of cell interactions linked to thrombosis, inflammation, and cancer metastasis under venous flow conditions.
21068098 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20962850 Observational study of gene-disease association. (HuGE Navigator)
20881011 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20848568 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20826754 we show that shedding of human CD11/CD18 complexes is a part of synovial inflammation in rheumatoid arthritis and spondyloarthritis but not in osteoarthritis
20824631 Our results identify Fc block treatment, dead cells, and cell doublets exclusion as simple but crucial steps for the proper analysis of tumor-infiltrating CD11b(+) cell populations.
20800911 Stent-induced activation of macrophage-1 antigen (Mac-1) on the surface of neutrophils might trigger their MMP-9 release, possibly leading to the mobilization of bone marrow-derived stem cells.
20706761 The alteration of CD11b expression of PMN caused by garenoxacin at 0.5, 5.0, and 100.0 mg/l is not considered to hamper the function of these first-line-defense phagocytes.
20666624 an association of the ITGAM 77His or 858Val variants with systemic lupus erythematosus incidence and some clinical manifestation of this autoimmune disorder
20666624 Observational study of gene-disease association. (HuGE Navigator)
20665668 Rap1-mediated activation of alpha(M)beta(2) in macrophages shares both common and distinct features from Rap1 activation of alpha(IIb)beta(3) expressed in CHO cells.
20629846 This meta-analysis demonstrates a significant association between ITGAM gene polymorphism and SLE in multiple ethnic populations.
20629846 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20580686 uPAR acts as a cofactor for iC3b binding to CR3 and regulates CR3-mediated phagocytosis.
20483667 The blockade of IL-1beta with anakinra and its effects on interleukin 8 (IL-8) levels and CD11b integrin expression in monocytes of type 1 diabetics are reported.
20423844 Kidney-Tonifying plus Blood-Promoting Recipe regulates CD11b/CD18 and Bcl-2/Bax expression in blood leukocytes and improves microcirculatory status in aged patients with kidney deficiency and blood stasis syndrome.
20228269 High CD11b is associated with therapy resistance- and minimal residual disease in precursor B-cell acute lymphoblastic leukemia
20190138 These results demonstrate a role of PKCdelta in alpha(M)beta(2)-mediated Foxp1 regulation in monocytes.
20185670 The immunomodulatory effects of ketamine are mediated via reduced interleukin-8 production in whole blood and expression of CD11b and CD16 on neutrophils.
19939855 results show a strong association between the risk allele (A) at rs1143679 of ITGAM and renal disease, discoid rash and immunological manifestations of systemic lupus erythematosus.
19939855 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19863185 The CR3(CD11b/CD18) on PMNs was measured in NLF sample via chemiluminescence, and the technique shows promise as a diagnostic method for measuring upper airway LPS exposure.
19833726 CCL2 and interleukin-6 promote survival of human CD11b+ peripheral blood mononuclear cells and induce M2-type macrophage polarization
19811837 Dectin-1, although indispensable for recognition of beta-glucan-bearing particles in mice, is not the major receptor for yeast particles in human neutrophils.
19800635 The combination of high environmental stress and low CNS serotonin lead to increased expression of the beta(2)-integrins CD11b and CD11c on monocyte cell surfaces.
19748962 study found no evidence from a combined analysis of 3336 cases and 3502 controls to support association, of the ITGAM variant, R77H, with rheumatoid arthritis in the Caucasian population
19747912 ATRA-induced increase of Vav1 expression and phosphorylation may be involved in recruiting PU.1 to the CD11b promoter and in regulating CD11b expression during the late stages of neutrophil differentiation of APL-derived promyelocytes.
19587009 suppressed ability of DCs to induce T cell proliferation was dependent on adhesive interactions between DCs and lymphatic endothelial cells that were mediated by the binding of Mac-1 on DCs to ICAM-1 on LECs.
19578722 histone modification including PRC2-mediated repressive histone marker H3K27me3 and active histone marker acH4 may involve in CD11b transcription during HL-60 leukemia cells reprogramming to terminal differentiation
19572148 Findings suggest the important role of the CD11b+/CD14/CD15+/CD33+ MDSCs in mediating immunosuppression in NSCLC.
19550115 The positive rates of both CD11b and CD14 in HL-60 cells were over 90% after 5-day treatment (2 micromol/L ATRA or 10 micromol/L NSC67657.
19546439 Data show that CD45, CD11b, CD15, and CD56 were diagnostic parameters with flow cytometry.
19480860 Findings indicate that the proposed CRP/CD11b ratio test could potentially assist physicians in determining an appropriate antibiotic treatment in patients with severe bacterial infection.
19387459 Study showed that ITGAM is associated as a risk factor for Systemic Lupus Erythematosus in Hispanic Americans.
19387459 Observational study of gene-disease association. (HuGE Navigator)
19286673 ITGAM was associated with disease susceptibility of systemic lupus erythematosus in Chinese and Thai populations.
19286673 Observational study of gene-disease association. (HuGE Navigator)
19250688 These changes in gene expression may reflect changes in the types of macrophages that populate the lesions in anti-CD11d mAb-treated rats.
19246218 Changes in external anion composition, not internal chloride or increases in Cl(-) efflux, are responsible for Mac-1 activation and increased adhesion to ICAM-1.
19135988 Data confirmed the increased monocyte alphaL, alphaM and beta2 integrin subunits in diabetes mellitus.
19129174 These results demonstrate that the coding variant, rs1143679, best explains the ITGAM-systemic lupus erythematosus association, especially in European- and African-derived populations, but not in Asian populations.
19129174 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19110536 Observational study of gene-disease association. (HuGE Navigator)
19086264 the role of protein kinase C zeta (PKCzeta) in interleukin (IL)-8-mediated activation of Mac-1 (CD11b/CD18) in human neutrophils
19073595 the heparan sulfate proteoglycan form of epithelial CD44v3 plays a critical role in facilitating PMN recruitment during inflammatory episodes via directly binding to CD11b/CD18.
19052753 Fibromyalgia patients showed a significantly decreased expression of CD11b on neutrophils.
18941116 Both uPAR small-interference RNA (siRNA) and soluble anti-beta(1)/-beta(2) monoclonal antibodies abolished the anti-HIV effects of uPA, whereas CD11b siRNA reversed the anti-HIV effect of M25, but not that induced by uPA
18842294 Observational study of gene-disease association. (HuGE Navigator)
18762778 Interleukin-33 enhances adhesion, CD11b expression and survival in human eosinophils
18714035 closely related alpha(M)beta(2) ligands, plasminogen and angiostatin, derived from plasminogen, as well as fibrinogen and its two derivative alpha(M)beta(2) recognition peptides, P1 and P2-C, differed markedly in their effects on neutrophil apoptosis.
18685529 Neutrophil chemotaxis and polarization were found to be impaired 24 h postexercise. Adherence was impaired 24 h postexercise as well, but the expression of the adhesion molecule CD11b/CD18 was not affected
18684982 A versatile beta 2 integrin adhesion molecule, CD11b, expressed by eosinophils plays a key role in recognizing and/or interacting with beta-glucan that is present on the surface of the fungus Alternaria alternata.
18678668 Streptococcus gordonii DL1 surface protein Hsa binds to the host cell membrane glycoproteins CD11b, CD43, and CD50
18676132 Down regulation of CD11b and CD18 expression in children with hypercholesterolemia: a preliminary report.
18644795 analysis of conformational changes in the alpha(M)beta(2) headpiece and reorientation of its transmembrane domains when alpha(M)beta(2) interacts with uPAR
18617697 Myeloperoxidase independent of its catalytic activity through signaling via the adhesion molecule CD11b/CD18 rescued human neutrophils from constitutive apoptosis and prolonged their life span.
18541300 The differential involvement of CD11c and CD11b in adhesion and subsequent cytoskeletal changes in monocytes exposed to different conditions.
18509085 cooperation of the alpha(M)beta(2)/GPIbalpha and to PSGL-1/P-selectin systems regulates the prothrombotic properties of PMN-derived microparticles and MP-induced platelet activation
18496641 Diabetic microangiopathy is accompanied by increase in CD11b expression and decrease in CD62L expression on peripheral blood neutrophils.
18495781 Myeloid zinc factor-1 is involved in a calcitriol-induced signaling pathway leading to myeloid cell differentiation and activation of CD11b and CD14.
18414903 Cancer patients with infection had higher blood neutrophil and monocyte CD11b/CD18 expression levels than patients with neoplastic fever, those with advanced cancer without infection, or healthy controls
18375764 Bordetella pertussis CyaA binding to CD11b/CD18
18204448 Observational study of gene-disease association. (HuGE Navigator)
18204448 A nonsynonymous functional variant in integrin-alpha(M)(encoded by ITGAM) is associated with systemic luopus erythematosus.
18204446 Genome-wide association study of gene-disease association. (HuGE Navigator)
18204446 study presents four new regions having genetic associations with systemic lupus erythematosus in women of European descent: ITGAM, KIAA1542, PXK and rs10798269
18204098 Genome-wide association study of gene-disease association. (HuGE Navigator)
18204098 identified and confirmed through replication two new genetic loci for SLE: a promoter-region allele associated with reduced expression of BLK and increased expression of C8orf13 and variants in the ITGAM-ITGAX region
18164590 TNF-alpha unveils a previously unknown capacity of neutrophils to migrate to CCL3 through the intervention of Mac-1.
18156711 Observational study of genotype prevalence. (HuGE Navigator)
18096476 IL1R2 was greatly decreased with future rejection and FLT3, ITGAM, and PDCD1 showed borderline changes in future cardiac rejections.
18065787 HD patients with a low P(HCO3) exhibited low neutrophil pHi that in turn increased the expression of CD11b/CD18. This increased expression of CD11b/CD18 on the uraemic neutrophils may contribute to the pHi-mediated phagocytosis.
17957461 Mannitol upregulates monocyte HLA-DR, monocyte and neutrophil CD11b, and inhibits neutrophil apoptosis.
17927697 We report that Bordetella persussis ACT ( adenylate cyclase toxin) induces COX-2 in HEK293T cells expressing Mac-1.
17721605 review focuses on the non-receptor tyrosine kinase Syk as an important downstream signaling component of beta2 integrins (CD11/CD18) that is required for the control of different PMN functions including adhesion, migration and phagocytosis.
17445870 both AGE-BSA and MG induce a dose-dependent expression of the adhesion molecule Mac-1 on the surface of neutrophils
17372166 observations identify interaction of CD40L and Mac-1 as an alternative pathway for CD40L-mediated inflammation; this novel mechanism expands understanding of inflammatory signaling during atherogenesis
17346796 PLD-synthesised PtdOH stimulates the generation of PtdIns(4,5)P(2), which in turn mediates talin binding to, and activation of, CD11b/CD18 required for neutrophil stable adhesion and migration.
17228360 We conclude that in vivo transmigrated leukocytes from patients on biocompatible high-flux hemodiafiltration or high-flux hemodialysis have a preserved capacity to express CD11b at the site of interstitial inflammation.
17202407 These results establish for the first time at least two distinct roles for talin during CR3/alpha(M)beta(2)-mediated phagocytosis, most noticeably activation of the CR3/alpha(M)beta(2) receptor and phagocytic uptake.
17202372 demonstrated the role of DC-SIGN in complement opsonized virus uptake and infection
17172930 Increased levels of cellular adhesion molecules in patients with coronary artery ectasia may be an indicator of endothelial activation and inflammation and are likely to be in the causal pathway leading to coronary artery ectasia.
16915040 telmisartan inhibits the expression of the pro-inflammatory beta2-integrin MAC-1 expression in lymphocytes independently of angiotensin II
16782049 Mac-1 subunits take different conformation when expressed in Chinese hamster ovary (CHO) and human embryonic kidney (HEK) 293T cells, respectively
16614246 While tolerogenic DCs are not induced via alphavbeta5, coligation of CR3 and alphavbeta5 maintains the DC's tolerogenic profile.
16508260 Both hypoxia and heat shock prevented the lipopolysaccharide-induced increase in adult CD11b.
16389569 CRP induces CD11b expression in monocytes through a peroxide independent pathway involving both Syk phosphorylation and [Ca(2+)](i) release.
16357311 Monocytes exposed to nonesterified fatty acids demonstrated a significant increase in CD11b message expression
16260637 Has been implicated in the firm adhesion and transmigration of leukocytes at sites of platelet deposition.
16249234 We demonstrate that cell movement in response to IL-8 is mediated by Mac-1, whereas LFA-1 is required for directional migration. By contrast, chemotaxis to fMLP requires Mac-1 for cell movement.
16239529 studies suggest that the activation and surface expression of CR3, FHA expression, and the efficiency of ACT internalization all influence whether B. pertussis will be phagocytosed and ultimately killed by neutrophils
16037628 In DVT subjects, at baseline, the phenotypical expression of CD11b was decreased and that of CD11c was increased, and upon PMN activation in DVT subjects CD11b, CD11c and CD18 increased, while CD11a expression did not show any change
15976367 Patients with higher peripheral CD11b expression showed a markedly augmented increase in dialysate glucose in adipose tissue during oral glucose tolerance testing and increased adipose tissue lipolysis as well.
15778383 findings reveal that mycobacteria promote their uptake through a process of "inside-out" signaling involving CD14, TLR2, PI3K, and cytohesin-1. This converts low avidity CR3 into an active receptor leading to increased bacterial internalization
15741160 The alphaM lectin domain (but not the alpha M I domain) mediates integrin alphaMbeta2-dependent phagocytosis of chilled platelets by myeloid cells.
15730520 Observational study of gene-disease association. (HuGE Navigator)
15718918 elastase binds to the beta(2)-integrin CD11b and induces a conformational alteration of CD11b
15641787 A novel binding region within the central domain of the fibrinogen gamma-module localizes within gamma chain residues 228-253 and has been identified as the integrin alpha M subunit of Mac-1.
15615722 the beta2I domain of integrin alphaMbeta2 has a site which supports ICAM-1 binding to alpha(M)beta(2) and controls the open and closed conformation of the alpha(M)beta(2) receptor
15585684 CD11b is increased on circulating phagocytes as an early sign of late-onset sepsis in extremely low-birth-weight infants
15485828 each subunit of alphaMbeta2 contributes distinct properties to alphaMbeta2 and that, in most but not all cases, the response of the integrin is a composite of the functions of its individual subunits
15454120 we have shown here that eosinophils from atopic children express Mac-1 and demonstrated that this expresion may be up regulated by fMLP.
15304494 studies of the interaction of the ligand binding alphaMI-domain of alphaMbeta2 with the D fragment of fibrinogen, which has multiple binding sites for integrin alphaMbeta2
15294914 BAP31 may play a role in regulating intracellular trafficking of CD11b/CD18 in neutrophils
15277376 Myeloid-related proteins-induced increased adhesion of monocytes to Fibronectin and upregulation of CD11b contribute to a facilitated accumulation of monocytes
15217824 platelet-activating factor or interleukin 8 acted in concert with P-selectin for further enhancing the activation of alphaMbeta2
15073035 Some anti-Mart antibodies interfere with Mac-1-dependent cellular functions of neutrophils.
15004192 The interaction between Mac-1 and Thy-1 is involved in the adhesion of leukocytes to activated endothelial cells as well as in subsequent transendothelial migration of leukocytes into the perivascular tissue.
14769799 assembly of Plg and uPA on integrin alpha(M)beta(2) regulates Plm activity and plays a crucial role in neutrophil-mediated thrombolysis
14751053 CD11b expression with the whole blood flow cytometry seemed feasible and reliable in the early diagnosis of neonatal sepsis.
14532278 cooperative engagement of CR3 on both the lectin-like site involved in beta-glucan binding and the I-domain involved in C3bi binding produces AA release
12960243 Interaction of proteinase 3 with CD11b/CD18 (beta2 integrin) on the cell membrane of human neutrophils.
12847278 The extracellular, membrane-proximal region of the CD11b receptor subunit plays an important role in integrin activation and therefore could be targeted by certain cell surface proteins as a conduit to control the integrin "inside-out" signaling process.
12816955 three separate domains of alpha M beta 2 (the alpha MI-domain, the alpha M beta-propeller, and the beta 2I-domain) function together and contribute to the formation of the C3bi-binding site
12760968 Our results indicate that induction of Ca2+ entry by the depletion of Ca2+ from intracellular stores upregulates CD11b/CD18 expression on eosinophils and primes eosinophil transmigration across lung epithelium.
12731070 Fibrinogen-CD11b/CD18 interaction activates the NF-kappa B pathway and delays apoptosis in human neutrophils.
12694184 ICAM-4 binds to the I domain of this integrin.
12682255 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, alpha M (ITGAM, CR3A) expression by HIV-1 Vpr in Vpr transduced macrophages
12665127 uPAR up-regulated the Mac-1 adhesion to fibrinogen, and focal adhesion kinase and MAPK were involved in this regulation
12600815 the expression of ICAM-1 might involve both p38 MAPK and NF-kappaB activities, whereas the regulation of CD11b, CD18, and ICAM-3 expressions might be mediated through p38 MAPK but not NF-kappaB.
12576754 Level of expression of the adhesion molecule/complement receptor CD11b/CD18 and the chemokine receptor IL-8 receptor-A was also higher after vaginal delivery.
12516552 Adhesion of dendritic cells derived from CD34+ progenitors to resting human dermal microvascular endothelial cells is down-regulated upon maturation and partially depends on CD11a-CD18, CD11b-CD18 and CD36.
12495676 Leptospira interrogans binds to the CR3 receptor on neutrophils
12485936 Mac-1 (CD11b/CD18) is crucial for effective Fc receptor-mediated immunity to melanoma.
12466503 Stabilizing the integrin alpha M inserted domain in alternative conformations with a range of engineered disulfide bonds.
12444150 The same lectin domain within CD11b regulates both the cytotoxic and adhesion functions of Mac-1/CR3.
12393719 ZBP-89 is a repressor of the human beta 2-integrin CD11b gene during differentiation of monocytes into macrophages
12393547 recognition of uPA by alpha(M)beta(2) allows for formation of a multicontact trimolecular complex, in which a single uPA ligand may bind to both uPAR and alpha(M)beta(2); interaction of uPA with each receptor influences cell adhesion and migration
12390020 The mechanism that regulates the unmasking of the integrin alpha M cryptic binding site in the gamma C-domain of fibrinogen has been identified.
12377937 iIgA promotes neutrophil apoptosis through a mechanism dependent on Mac-1(CD11b) cooperation, which involves the activation of the respiratory burst
12377763 investigation of molecular basis for broad ligand recognition
12244179 Mac-1 (CD11b) is required for neutrophil-Fc alpha RI binding of secretory IgA and subsequent neutrophil activation.
12234260 Histoplasma capsulatum inhibits apoptosis and Mac-1 expression in leucocytes.
12208882 The junctional adhesion molecule 3 (JAM-3) on human platelets is a counterreceptor for the leukocyte integrin Mac-1.
12165526 mediates type I phagocytosis under nonopsonic conditions and type II under opsonic conditions
12145463 Increased expression of CD11b/CD18 adhesion molecules was obtained in PV and ET patients, which could be associated with increased leukocyte adehesiveness contributing to the hypercoagulable state.
12107753 Impaired neutrophil actin assembly causes persistent expression and reduced primary granule exocytosis in Type II diabetes
12036876 Identification of integrin alpha(M)beta(2) as an adhesion receptor on human peripheral blood monocytes for Cyr61 and connective tissue growth factor: immediate-early gene products expressed in atherosclerotic lesions.(integrin alpha(M)beta(2))
12009501 fibroblasts prostaglandin-E2 is elevated in Alzheimer's disease (prostaglandin-E2, PGE2)
11953106 CD11b may play an important role in pathogenic process(in COPD)
11937770 Respiratory syncytial virus enhances the expression of CD11b molecules by human eosinophils primed with platelet-activating factor
11893077 CD11b-mediated adhesion of myeloid leukemia cells in the course of induced monocytic differentiation is crucial for cell attachment, development of a monocytic phenotype and subsequent survival.
11881155 Mac-1 molecules mediated cell adhesion predominantly to fibrinogen, and its early degradation products, fragments X and Y
1967280 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, alpha M (ITGAM, CR3A) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQRGSLYQCDYST      1 - 70
GSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEA     71 - 140
LRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPN    141 - 210
PRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGV    211 - 280
IRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEM    281 - 350
SQEGFSAAITSNGPLLSTVGSYDWAGGVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLV    351 - 420
LGAPRYQHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAPHYYEQTRGGQ    421 - 490
VSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAIGAPGEEDNRGAVYLFHGTSG    491 - 560
SGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVDLTVGAQGHVLLLRSQPVLRVKAIMEFNPRE    561 - 630
VARNVFECNDQVVKGKEAGEVRVCLHVQKSTRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRR    631 - 700
QTQVLGLTQTCETLKLQLPNCIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNC    701 - 770
GNDNICQDDLSITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQ    771 - 840
RSWRLACESASSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKANVTSENNMPRT    841 - 910
NKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNLGQRSLPISLVFLVPVRLNQT    911 - 980
VIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVVNCSIAVCQRIQCDIPFFGIQEEFNATLKGN    981 - 1050
LSFDWYIKTSHNHLLIVSTAEILFNDSVFTLLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLL   1051 - 1120
ALITAALYKLGFFKRQYKDMMSEGGPPGAEPQ                                         1121 - 1152
//

Text Mined References (264)

PMID Year Title
27055590 2016 LFA-1 and Mac-1 integrins bind to the serine/threonine-rich domain of thrombomodulin.
26852488 2015 [Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria].
26512111 2015 RNA sensing by conventional dendritic cells is central to the development of lupus nephritis.
26361072 2015 Human neutrophil antigen-3a antibodies induce neutrophil stiffening and conformational activation of CD11b without shedding of L-selectin.
26309131 2015 Prognostic Value of CD11b Expression Level for Acute Myeloid Leukemia Patients: A Meta-Analysis.
26306739 2015 Secreted aspartic protease 2 of Candida albicans inactivates factor H and the macrophage factor H-receptors CR3 (CD11b/CD18) and CR4 (CD11c/CD18).
26293614 2015 Contact activation of C3 enables tethering between activated platelets and polymorphonuclear leukocytes via CD11b/CD18.
26170143 2015 The heteromeric transcription factor GABP activates the ITGAM/CD11b promoter and induces myeloid differentiation.
26036990 2015 The opioid peptide dynorphin A induces leukocyte responses via integrin Mac-1 (?M?2, CD11b/CD18).
25971554 2015 Expression of folate receptors alpha and beta in normal and cancerous gynecologic tissues: correlation of expression of the beta isoform with macrophage markers.
25826119 2015 Neutrophil and monocyte toll-like receptor 4, CD11b and reactive oxygen intermediates, and neuroimaging outcomes in preterm infants.
25678086 2015 Rare variants at 16p11.2 are associated with common variable immunodeficiency.
25655529 2016 Persistent systemic monocyte and neutrophil activation in neonatal encephalopathy.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
25613106 2015 Ligand recognition specificity of leukocyte integrin ?M?2 (Mac-1, CD11b/CD18) and its functional consequences.
25554420 2015 Interaction of Bordetella adenylate cyclase toxin with complement receptor 3 involves multivalent glycan binding.
25461401 2015 An anti-inflammatory property of Candida albicans ?-glucan: Induction of high levels of interleukin-1 receptor antagonist via a Dectin-1/CR3 independent mechanism.
25365491 2014 Role of CD11b/CD18 in priming of human leukocytes by endotoxin glycoforms from Escherichia coli.
25315704 2015 Association between the functional ITGAM rs1143679 G/A polymorphism and systemic lupus erythematosus/lupus nephritis or rheumatoid arthritis: an update meta-analysis.
25305756 2014 Discovery of new risk loci for IgA nephropathy implicates genes involved in immunity against intestinal pathogens.
25238263 2014 IL-6-stimulated CD11b+ CD14+ HLA-DR- myeloid-derived suppressor cells, are associated with progression and poor prognosis in squamous cell carcinoma of the esophagus.
25231265 2015 ?2 integrins (CD11/18) are essential for the chemosensory adhesion and migration of polymorphonuclear leukocytes on bacterial cellulose.
25136078 2014 Detailed analysis of bone marrow from patients with ischemic heart disease and left ventricular dysfunction: BM CD34, CD11b, and clonogenic capacity as biomarkers for clinical outcomes.
25024378 2014 Immobilized immune complexes induce neutrophil extracellular trap release by human neutrophil granulocytes via Fc?RIIIB and Mac-1.
25005557 2014 hnRNP K in PU.1-containing complexes recruited at the CD11b promoter: a distinct role in modulating granulocytic and monocytic differentiation of AML-derived cells.
24945596 2014 Influence of Fc?RIIIb polymorphism on its ability to cooperate with Fc?RIIa and CR3 in mediating the oxidative burst of human neutrophils.
24886912 2014 Resequencing the susceptibility gene, ITGAM, identifies two functionally deleterious rare variants in systemic lupus erythematosus cases.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24829201 2014 Trisomy 12 chronic lymphocytic leukemia cells exhibit upregulation of integrin signaling that is modulated by NOTCH1 mutations.
24782118 2014 Correlation of CD11b and CD56 expression in adult acute myeloid leukemia with cytogenetic risk groups and prognosis.
24726062 2014 Lipopolysaccharide-mediated enhancement of zymosan phagocytosis by RAW 264.7 macrophages is independent of opsonins, laminarin, mannan, and complement receptor 3.
24608226 2014 Combined protein- and nucleic acid-level effects of rs1143679 (R77H), a lupus-predisposing variant within ITGAM.
24269694 2014 The variant of CD11b, rs1143679 within ITGAM, is associated with systemic lupus erythematosus and clinical manifestations in Brazilian patients.
24264377 2013 Integrin CD11b negatively regulates BCR signalling to maintain autoreactive B cell tolerance.
23981064 2014 Mycobacterium tuberculosis infection of human dendritic cells decreases integrin expression, adhesion and migration to chemokines.
23918739 2013 Multiple lupus-associated ITGAM variants alter Mac-1 functions on neutrophils.
23880611 2013 Upregulation of CD11b on eosinophils in aspirin induced asthma.
23812215 Hypothermia inhibits expression of CD11b (MAC-1) and CD162 (PSGL-1) on monocytes during extracorporeal circulation.
23754403 2013 Staphylococcus aureus LukAB cytotoxin kills human neutrophils by targeting the CD11b subunit of the integrin Mac-1.
23753600 2013 The CD11b-integrin (ITGAM) and systemic lupus erythematosus.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23727038 2013 Rhinovirus colocalizes with CD68- and CD11b-positive macrophages following experimental infection in humans.
23720274 2013 5-Lipoxygenase plays a pivotal role in endothelial adhesion of monocytes via an increased expression of Mac-1.
23708937 2014 Decreased ITGAM and Fc?RIIIA mRNA expression levels in peripheral blood mononuclear cells from patients with systemic lupus erythematosus.
23686079 2013 Fasting glucose level modulates cell surface expression of CD11b and CD66b in granulocytes and monocytes of patients with type 2 diabetes.
23671673 2013 Identifying early inflammatory changes in monocyte-derived macrophages from a population with IQ-discrepant episodic memory.
23573259 2013 Toll-Like Receptor induced CD11b and L-selectin response in patients with coronary artery disease.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23514737 2013 Distinct binding affinities of Mac-1 and LFA-1 in neutrophil activation.
23479224 2013 Monocyte ADAM17 promotes diapedesis during transendothelial migration: identification of steps and substrates targeted by metalloproteinases.
23469114 2013 EM structure of the ectodomain of integrin CD11b/CD18 and localization of its ligand-binding site relative to the plasma membrane.
23452299 2013 CD64-Neutrophil expression and stress metabolic patterns in early sepsis and severe traumatic brain injury in children.
23451151 2013 Phagocytosis is the main CR3-mediated function affected by the lupus-associated variant of CD11b in human myeloid cells.
23398146 2013 Determination of human neutrophil antigen-1, -3, -4 and -5 allele frequencies in English Caucasoid blood donors using a multiplex fluorescent DNA-based assay.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23334594 2013 Selective upregulation of scavenger receptors in and around demyelinating areas in multiple sclerosis.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23269830 2012 Pilus adhesin RrgA interacts with complement receptor 3, thereby affecting macrophage function and systemic pneumococcal disease.
23257917 2013 Increased expression levels of integrin ?9?1 and CD11b on circulating neutrophils and elevated serum IL-17A in elderly aspiration pneumonia.
23184931 2013 From macrophage interleukin-13 receptor to foam cell formation: mechanisms for ?M?2 integrin interference.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
23092917 2013 CD11b expression correlates with monosomal karyotype and predicts an extremely poor prognosis in cytogenetically unfavorable acute myeloid leukemia.
22893614 2013 Negative regulation of osteoclast precursor differentiation by CD11b and ?2 integrin-B-cell lymphoma 6 signaling.
22722613 2012 Marked differences in the signaling requirements for expression of CD203c and CD11b versus CD63 expression and histamine release in human basophils.
22586164 2012 The rs1143679 (R77H) lupus associated variant of ITGAM (CD11b) impairs complement receptor 3 mediated functions in human monocytes.
22552879 2012 ?(M)?(2)-integrin-intercellular adhesion molecule-1 interactions drive the flow-dependent trafficking of Guillain-Barré syndrome patient derived mononuclear leukocytes at the blood-nerve barrier in vitro.
22251373 2012 Identification and evaluation of novel synovial tissue biomarkers in rheumatoid arthritis by laser scanning cytometry.
22229891 2012 IL-8 from local subcutaneous wounds regulates CD11b activation.
22095715 2011 Stable coordination of the inhibitory Ca2+ ion at the metal ion-dependent adhesion site in integrin CD11b/CD18 by an antibody-derived ligand aspartate: implications for integrin regulation and structure-based drug design.
22053606 2010 Effect of surgically-induced weight loss on inflammatory mediators and peripheral blood monocyte CD11b expression in morbid obesity.
22052909 2011 Structures and interaction analyses of integrin ?M?2 cytoplasmic tails.
21874872 2011 [Participation of beta2-integrins CD11b/CD18 and CD11c/CD18 in adhesion and migration of cells on fibrinogen].
21840425 2012 Evaluation of genetic association between an ITGAM non-synonymous SNP (rs1143679) and multiple autoimmune diseases.
21676865 2011 Molecular basis for the interaction of low density lipoprotein receptor-related protein 1 (LRP1) with integrin alphaMbeta2: identification of binding sites within alphaMbeta2 for LRP1.
21610569 2011 Trauma-activated polymorphonucleated leukocytes damage endothelial progenitor cells: probable role of CD11b/CD18-CD54 interaction and release of reactive oxygen species.
21571730 2011 Association of a non-synonymous functional variant of the ITGAM gene with systemic sclerosis.
21551251 2011 Endogenous PMN sialidase activity exposes activation epitope on CD11b/CD18 which enhances its binding interaction with ICAM-1.
21454473 2011 A systemic lupus erythematosus-associated R77H substitution in the CD11b chain of the Mac-1 integrin compromises leukocyte adhesion and phagocytosis.
21408207 2011 Differential genetic associations for systemic lupus erythematosus based on anti-dsDNA autoantibody production.
21403131 2011 Cleavage of the CD11b extracellular domain by the leukocyte serprocidins is critical for neutrophil detachment during chemotaxis.
21362770 2011 Association study of ITGAM, ITGAX, and CD58 autoimmune risk loci in systemic sclerosis: results from 2 large European Caucasian cohorts.
21273385 2011 Mycobacterial hypersensitivity pneumonitis requires TLR9-MyD88 in lung CD11b+ CD11c+ cells.
21263017 2011 Lipoxin A? inhibits porphyromonas gingivalis-induced aggregation and reactive oxygen species production by modulating neutrophil-platelet interaction and CD11b expression.
21252155 2011 ?M?? integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.
21151989 2010 Polymorphisms of the ITGAM gene confer higher risk of discoid cutaneous than of systemic lupus erythematosus.
21135163 2011 Sequential binding of ?V?3 and ICAM-1 determines fibrin-mediated melanoma capture and stable adhesion to CD11b/CD18 on neutrophils.
21068098 2011 Study of the common genetic background for rheumatoid arthritis and systemic lupus erythematosus.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20881011 2011 Early disease onset is predicted by a higher genetic risk for lupus and is associated with a more severe phenotype in lupus patients.
20848568 2010 Genetically determined Amerindian ancestry correlates with increased frequency of risk alleles for systemic lupus erythematosus.
20826754 2010 Shedding of large functionally active CD11/CD18 Integrin complexes from leukocyte membranes during synovial inflammation distinguishes three types of arthritis through differential epitope exposure.
20824631 2010 Fc block treatment, dead cells exclusion, and cell aggregates discrimination concur to prevent phenotypical artifacts in the analysis of subpopulations of tumor-infiltrating CD11b(+) myelomonocytic cells.
20800911 2011 Activation of matrix metalloproteinase-9 is associated with mobilization of bone marrow-derived cells after coronary stent implantation.
20706761 2011 Garenoxacin-induced increase of CD11b expression on human polymorphonuclear neutrophils does not affect phagocytosis and killing of Staphylococcus aureus.
20666624 2011 ITGAM Arg77His is associated with disease susceptibility, arthritis, and renal symptoms in systemic lupus erythematosus patients from a sample of the Polish population.
20665668 2010 Rap1 controls activation of the ?(M)?(2) integrin in a talin-dependent manner.
20629846 2011 Association of ITGAM polymorphism with systemic lupus erythematosus: a meta-analysis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20580686 2010 Urokinase receptor (uPAR) regulates complement receptor 3 (CR3)-mediated neutrophil phagocytosis.
20483667 2010 Short-term IL-1beta blockade reduces monocyte CD11b integrin expression in an IL-8 dependent fashion in patients with type 1 diabetes.
20423844 2010 [Effect of Kidney-Tonifying and Blood-Promoting Recipe on the expression of CD11b/CD18 and Bcl-2/Bax in aged patients with kidney deficiency and blood stasis syndrome].
20228269 2010 CD11b is a therapy resistance- and minimal residual disease-specific marker in precursor B-cell acute lymphoblastic leukemia.
20190138 2010 Integrin alphaMbeta2 clustering triggers phosphorylation and activation of protein kinase C delta that regulates transcription factor Foxp1 expression in monocytes.
20185670 2010 Ketamine inhibits transcription factors activator protein 1 and nuclear factor-kappaB, interleukin-8 production, as well as CD11b and CD16 expression: studies in human leukocytes and leukocytic cell lines.
19939855 2010 ITGAM coding variant (rs1143679) influences the risk of renal disease, discoid rash and immunological manifestations in patients with systemic lupus erythematosus with European ancestry.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19863185 2009 CR3 (CD11b/CD18) activation of nasal neutrophils: a measure of upper airway endotoxin exposure.
19833726 2009 CCL2 and interleukin-6 promote survival of human CD11b+ peripheral blood mononuclear cells and induce M2-type macrophage polarization.
19811837 2009 Complement receptor 3, not Dectin-1, is the major receptor on human neutrophils for beta-glucan-bearing particles.
19800635 2010 Socioeconomic status moderates associations between CNS serotonin and expression of beta2-integrins CD11b and CD11c.
19748962 2009 No evidence for association of the systemic lupus erythematosus-associated ITGAM variant, R77H, with rheumatoid arthritis in the Caucasian population.
19747912 2010 Vav1 and PU.1 are recruited to the CD11b promoter in APL-derived promyelocytes: role of Vav1 in modulating PU.1-containing complexes during ATRA-induced differentiation.
19587009 2009 Inflamed lymphatic endothelium suppresses dendritic cell maturation and function via Mac-1/ICAM-1-dependent mechanism.
19578722 2009 Regulation of CD11b transcription by decreasing PRC2 and increased acH4 level during ATRA-induced HL-60 differentiation.
19572148 2010 Population alterations of L-arginase- and inducible nitric oxide synthase-expressed CD11b+/CD14?/CD15+/CD33+ myeloid-derived suppressor cells and CD8+ T lymphocytes in patients with advanced-stage non-small cell lung cancer.
19550115 2009 Comparative proteomics analysis on differentiation of human promyelocytic leukemia HL-60 cells into granulocyte and monocyte lineages.
19546439 2009 Diagnostic utility of flow cytometry in low-grade myelodysplastic syndromes: a prospective validation study.
19480860 2009 CRP/CD11b ratio: a novel parameter for detecting gram-positive sepsis.
19387459 2009 Admixture in Hispanic Americans: its impact on ITGAM association and implications for admixture mapping in SLE.
19286673 2009 ITGAM is associated with disease susceptibility and renal nephritis of systemic lupus erythematosus in Hong Kong Chinese and Thai.
19250688 2009 Gene expression profiling in anti-CD11d mAb-treated spinal cord-injured rats.
19246218 Activation of human neutrophil Mac-1 by anion substitution.
19234460 2009 A point mutation in KINDLIN3 ablates activation of three integrin subfamilies in humans.
19165918 2008 Genetic variants near TNFAIP3 on 6q23 are associated with systemic lupus erythematosus.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19135988 2009 Increased monocyte alphaL, alphaM and beta2 integrin subunits in diabetes mellitus.
19129174 2009 Evaluation of imputation-based association in and around the integrin-alpha-M (ITGAM) gene and replication of robust association between a non-synonymous functional variant within ITGAM and systemic lupus erythematosus (SLE).
19110536 2009 Analysis of 17 autoimmune disease-associated variants in type 1 diabetes identifies 6q23/TNFAIP3 as a susceptibility locus.
19086264 2008 The atypical zeta (zeta) isoform of protein kinase C regulates CD11b/CD18 activation in human neutrophils.
19073595 2009 The heparan sulfate proteoglycan form of epithelial CD44v3 serves as a CD11b/CD18 counter-receptor during polymorphonuclear leukocyte transepithelial migration.
19052753 2009 Decrease in adhesion molecules on polymorphonuclear leukocytes of patients with fibromyalgia.
18941116 2009 Ligand-engaged urokinase-type plasminogen activator receptor and activation of the CD11b/CD18 integrin inhibit late events of HIV expression in monocytic cells.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18762778 2008 Interleukin-33 enhances adhesion, CD11b expression and survival in human eosinophils.
18714035 2008 Neutrophil apoptosis: selective regulation by different ligands of integrin alphaMbeta2.
18685529 2008 The effect of aerobic exercise on neutrophil functions.
18684982 2008 Innate antifungal immunity of human eosinophils mediated by a beta 2 integrin, CD11b.
18678668 2008 Binding of the Streptococcus gordonii DL1 surface protein Hsa to the host cell membrane glycoproteins CD11b, CD43, and CD50.
18676132 2009 Down regulation of CD11b and CD18 expression in children with hypercholesterolemia: a preliminary report.
18644795 2008 Urokinase-type plasminogen activator receptor induces conformational changes in the integrin alphaMbeta2 headpiece and reorientation of its transmembrane domains.
18617697 2008 Myeloperoxidase delays neutrophil apoptosis through CD11b/CD18 integrins and prolongs inflammation.
18541300 2008 Integrin CD11c contributes to monocyte adhesion with CD11b in a differential manner and requires Src family kinase activity.
18509085 2008 Expression, activation, and function of integrin alphaMbeta2 (Mac-1) on neutrophil-derived microparticles.
18496641 2008 Neutrophil surface expression of CD11b and CD62L in diabetic microangiopathy.
18495781 2008 Myeloid cell differentiation in response to calcitriol for expression CD11b and CD14 is regulated by myeloid zinc finger-1 protein downstream of phosphatidylinositol 3-kinase.
18414903 2008 Expression of CD11b/CD18 adhesion molecules on circulating phagocytes-a novel aid to diagnose infection in patients with cancer.
18375764 2008 RTX cytotoxins recognize beta2 integrin receptors through N-linked oligosaccharides.
18204448 2008 A nonsynonymous functional variant in integrin-alpha(M) (encoded by ITGAM) is associated with systemic lupus erythematosus.
18204446 2008 Genome-wide association scan in women with systemic lupus erythematosus identifies susceptibility variants in ITGAM, PXK, KIAA1542 and other loci.
18204098 2008 Association of systemic lupus erythematosus with C8orf13-BLK and ITGAM-ITGAX.
18164590 2008 Tumor necrosis factor-alpha (TNF-alpha) induces integrin CD11b/CD18 (Mac-1) up-regulation and migration to the CC chemokine CCL3 (MIP-1alpha) on human neutrophils through defined signalling pathways.
18156711 2006 Gene frequencies of human neutrophil antigens 4a and 5a in the korean population.
18096476 2007 Transcriptional signals of T-cell and corticosteroid-sensitive genes are associated with future acute cellular rejection in cardiac allografts.
18065787 2008 Intracellular acidification enhances neutrophil phagocytosis in chronic haemodialysis patients: possible role of CD11b/CD18.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17957461 2008 Mannitol upregulates monocyte HLA-DR, monocyte and neutrophil CD11b, and inhibits neutrophil apoptosis.
17927697 2007 Bordetella pertussis adenylate cyclase toxin (ACT) induces cyclooxygenase-2 (COX-2) in murine macrophages and is facilitated by ACT interaction with CD11b/CD18 (Mac-1).
17721605 2007 Neutrophil activation via beta2 integrins (CD11/CD18): molecular mechanisms and clinical implications.
17445870 2007 AGEs and methylglyoxal induce apoptosis and expression of Mac-1 on neutrophils resulting in platelet-neutrophil aggregation.
17372166 2007 CD40 ligand mediates inflammation independently of CD40 by interaction with Mac-1.
17346796 2007 Stable adhesion and migration of human neutrophils requires phospholipase D-mediated activation of the integrin CD11b/CD18.
17228360 2007 Preserved leukocyte CD11b expression at the site of interstitial inflammation in patients with high-flux hemodiafiltration.
17202407 2007 An essential role for talin during alpha(M)beta(2)-mediated phagocytosis.
17202372 2007 Opsonization of HIV with complement enhances infection of dendritic cells and viral transfer to CD4 T cells in a CR3 and DC-SIGN-dependent manner.
17172930 2007 Expression of monocyte and lymphocyte adhesion molecules is increased in isolated coronary artery ectasia.
16915040 2006 Telmisartan inhibits beta2-integrin MAC-1 expression in human T-lymphocytes.
16782049 2006 Detection of constitutive heterodimerization of the integrin Mac-1 subunits by fluorescence resonance energy transfer in living cells.
16614246 2006 The apoptotic-cell receptor CR3, but not alphavbeta5, is a regulator of human dendritic-cell immunostimulatory function.
16508260 2006 Effects of heat shock and hypoxia on neonatal neutrophil lipopolysaccharide responses: altered apoptosis, Toll-like receptor-4 and CD11b expression compared with adults.
16389569 2005 C-reactive protein mediates CD11b expression in monocytes through the non-receptor tyrosine kinase, Syk, and calcium mobilization but not through cytosolic peroxides.
16357311 2006 Elevated concentrations of nonesterified fatty acids increase monocyte expression of CD11b and adhesion to endothelial cells.
16260637 2005 Leukocyte engagement of platelet glycoprotein Ibalpha via the integrin Mac-1 is critical for the biological response to vascular injury.
16249234 2005 Fundamentally different roles for LFA-1, Mac-1 and alpha4-integrin in neutrophil chemotaxis.
16246332 2005 Interactions of DC-SIGN with Mac-1 and CEACAM1 regulate contact between dendritic cells and neutrophils.
16239529 2005 Influence of CR3 (CD11b/CD18) expression on phagocytosis of Bordetella pertussis by human neutrophils.
16037628 2005 Deep venous thrombosis: behaviour of the polymorphonuclear leukocyte integrin pattern at baseline and after in vitro activation.
15976367 2005 Adipose tissue metabolism and CD11b expression on monocytes in obese hypertensives.
15778383 2005 Cross-talk between CD14 and complement receptor 3 promotes phagocytosis of mycobacteria: regulation by phosphatidylinositol 3-kinase and cytohesin-1.
15741160 2005 The macrophage alphaMbeta2 integrin alphaM lectin domain mediates the phagocytosis of chilled platelets.
15730520 2005 Haplotype analysis of the CD11 gene cluster in patients with chronic Helicobacter pylori infection and gastric ulcer disease.
15718918 2005 Expression of elastase on polymorphonuclear neutrophils in vitro and in vivo: identification of CD11b as ligand for the surface-bound elastase.
15641787 2005 Interaction of fibrin(ogen) with leukocyte receptor alpha M beta 2 (Mac-1): further characterization and identification of a novel binding region within the central domain of the fibrinogen gamma-module.
15615722 2005 Dual function for a unique site within the beta2I domain of integrin alphaMbeta2.
15585684 2005 Increased CD11b-density on circulating phagocytes as an early sign of late-onset sepsis in extremely low-birth-weight infants.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485828 2005 Distinct roles for the alpha and beta subunits in the functions of integrin alphaMbeta2.
15454120 2004 Concentration-dependent activity of mometasone furoate and dexamethasone on blood eosinophils isolated from atopic children: modulation of Mac-1 expression and chemotaxis.
15304494 2004 Multiple binding sites in fibrinogen for integrin alphaMbeta2 (Mac-1).
15294914 2004 Association of BAP31 with CD11b/CD18. Potential role in intracellular trafficking of CD11b/CD18 in neutrophils.
15277376 2004 Increased serum levels of MRP-8/14 in type 1 diabetes induce an increased expression of CD11b and an enhanced adhesion of circulating monocytes to fibronectin.
15217824 2004 P-selectin binding to P-selectin glycoprotein ligand-1 induces an intermediate state of alphaMbeta2 activation and acts cooperatively with extracellular stimuli to support maximal adhesion of human neutrophils.
15194813 2004 JAM-C is a component of desmosomes and a ligand for CD11b/CD18-mediated neutrophil transepithelial migration.
15073035 2004 Human alloantibody anti-Mart interferes with Mac-1-dependent leukocyte adhesion.
15004192 2004 Human Thy-1 (CD90) on activated endothelial cells is a counterreceptor for the leukocyte integrin Mac-1 (CD11b/CD18).
14769799 2004 Integrin alphaMbeta2 orchestrates and accelerates plasminogen activation and fibrinolysis by neutrophils.
14751053 2003 [Expression of neutrophil adhesion molecule CD11b as an early diagnostic marker for neonatal sepsis].
14532278 2003 Release of arachidonic acid by stimulation of opsonic receptors in human monocytes: the FcgammaR and the complement receptor 3 pathways.
12960243 2003 Interaction of proteinase 3 with CD11b/CD18 (beta2 integrin) on the cell membrane of human neutrophils.
12847278 2003 Modulation of CD11b/CD18 adhesive activity by its extracellular, membrane-proximal regions.
12816955 2003 The fourth blade within the beta-propeller is involved specifically in C3bi recognition by integrin alpha M beta 2.
12760968 2003 Priming of eosinophil migration across lung epithelial cell monolayers and upregulation of CD11b/CD18 are elicited by extracellular Ca2+.
12731070 2003 Fibrinogen-CD11b/CD18 interaction activates the NF-kappa B pathway and delays apoptosis in human neutrophils.
12694184 2003 Characterization of ICAM-4 binding to the I domains of the CD11a/CD18 and CD11b/CD18 leukocyte integrins.
12665127 2003 Regulation of CD11b/CD18 (Mac-1) adhesion to fibrinogen by urokinase receptor (uPAR).
12600815 2003 Interleukin-3, -5, and granulocyte macrophage colony-stimulating factor-induced adhesion molecule expression on eosinophils by p38 mitogen-activated protein kinase and nuclear factor-[kappa] B.
12576754 2003 Increased respiratory burst and increased expression of complement receptor-3 (CD11b/CD18) and of IL-8 receptor-A in neutrophil granulocytes from newborns after vaginal delivery.
12516552 2002 Adhesion of dendritic cells derived from CD34+ progenitors to resting human dermal microvascular endothelial cells is down-regulated upon maturation and partially depends on CD11a-CD18, CD11b-CD18 and CD36.
12495676 2002 Leptospira interrogans binds to the CR3 receptor on mammalian cells.
12485936 2003 Mac-1 (CD11b/CD18) is crucial for effective Fc receptor-mediated immunity to melanoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466503 2002 Stabilizing the integrin alpha M inserted domain in alternative conformations with a range of engineered disulfide bonds.
12444150 2002 Function of the lectin domain of Mac-1/complement receptor type 3 (CD11b/CD18) in regulating neutrophil adhesion.
12393719 2003 The zinc finger transcription factor ZBP-89 is a repressor of the human beta 2-integrin CD11b gene.
12393547 2003 Convergence of the adhesive and fibrinolytic systems: recognition of urokinase by integrin alpha Mbeta 2 as well as by the urokinase receptor regulates cell adhesion and migration.
12390020 2002 Regulated unmasking of the cryptic binding site for integrin alpha M beta 2 in the gamma C-domain of fibrinogen.
12377937 2002 Stimulation of neutrophil apoptosis by immobilized IgA.
12377763 2002 A molecular basis for integrin alphaMbeta 2 ligand binding promiscuity.
12244179 2002 Mac-1 (CD11b/CD18) as accessory molecule for Fc alpha R (CD89) binding of IgA.
12234260 2002 Histoplasma capsulatum inhibits apoptosis and Mac-1 expression in leucocytes.
12208882 2002 The junctional adhesion molecule 3 (JAM-3) on human platelets is a counterreceptor for the leukocyte integrin Mac-1.
12165526 2002 Complement receptor 3 (CD11b/CD18) mediates type I and type II phagocytosis during nonopsonic and opsonic phagocytosis, respectively.
12145463 2002 Increased CD11/CD18 expression and altered metabolic activity on polymorphonuclear leukocytes from patients with polycythemia vera and essential thrombocythemia.
12107753 2002 Impaired neutrophil actin assembly causes persistent CD11b expression and reduced primary granule exocytosis in Type II diabetes.
12042322 2002 Ancient ubiquitous protein 1 binds to the conserved membrane-proximal sequence of the cytoplasmic tail of the integrin alpha subunits that plays a crucial role in the inside-out signaling of alpha IIbbeta 3.
12036876 2002 Identification of integrin alpha(M)beta(2) as an adhesion receptor on peripheral blood monocytes for Cyr61 (CCN1) and connective tissue growth factor (CCN2): immediate-early gene products expressed in atherosclerotic lesions.
12009501 Neutrophils CD11b and fibroblasts PGE(2) are elevated in Alzheimer's disease.
11967116 2002 Haptoglobin interacts with the human mast cell line HMC-1 and inhibits its spontaneous proliferation.
11953106 2002 [Study of the function of leukocyte adhesion molecules in chronic respiratory diseases].
11941318 2002 Leukotriene D4 upregulates eosinophil adhesion via the cysteinyl leukotriene 1 receptor.
11893077 2002 Antisense CD11b integrin inhibits the development of a differentiated monocyte/macrophage phenotype in human leukemia cells.
11881155 2001 [The role of Mac-1 and ICAM-1 molecules in adhesion of cells on fibronogen and its degradation products].
11843895 2002 Activation of granulocytes in patients treated with chemotherapy.
11701612 2001 Leukocyte integrin Mac-1 recruits toll/interleukin-1 receptor superfamily signaling intermediates to modulate NF-kappaB activity.
11073102 2000 AlphaMbeta2 (CD11b/CD18, Mac-1) integrin activation by a unique monoclonal antibody to alphaM I domain that is divalent cation-sensitive.
10946284 2000 Effect of integrin beta 2 subunit truncations on LFA-1 (CD11a/CD18) and Mac-1 (CD11b/CD18) assembly, surface expression, and function.
10899906 2000 Platelet glycoprotein ibalpha is a counterreceptor for the leukocyte integrin Mac-1 (CD11b/CD18).
10846180 2000 Binding sites of leukocyte beta 2 integrins (LFA-1, Mac-1) on the human ICAM-4/LW blood group protein.
10748078 2000 L-selectin signaling of neutrophil adhesion and degranulation involves p38 mitogen-activated protein kinase.
10744708 2000 Identification of a urokinase receptor-integrin interaction site. Promiscuous regulator of integrin function.
10352278 1999 ICAM-2 and a peptide from its binding domain are efficient activators of leukocyte adhesion and integrin affinity.
9844058 1998 A mixed population of immature and mature leucocytes in umbilical cord blood results in a reduced expression and function of CR3 (CD11b/CD18).
9712878 1998 Identification of a novel recognition sequence for integrin alphaM beta2 within the gamma-chain of fibrinogen.
9687375 1998 Cation binding to the integrin CD11b I domain and activation model assessment.
9569238 1998 Ligation of the beta2 integrin triggers activation and degranulation of human eosinophils.
9560195 1998 Experimental support for a beta-propeller domain in integrin alpha-subunits and a calcium binding site on its lower surface.
9558116 1998 Human polymorphonuclear leukocytes adhere to complement factor H through an interaction that involves alphaMbeta2 (CD11b/CD18).
9488691 1998 Peptides derived from the complementarity-determining regions of anti-Mac-1 antibodies block intercellular adhesion molecule-1 interaction with Mac-1.
9211902 1997 Identification and reconstruction of the binding site within alphaMbeta2 for a specific and high affinity ligand, NIF.
9175709 1997 Myeloperoxidase mediates cell adhesion via the alpha M beta 2 integrin (Mac-1, CD11b/CD18).
9142045 1997 Beta 2 (CD11/CD18) integrins can serve as signaling partners for other leukocyte receptors.
8747460 1995 Two conformations of the integrin A-domain (I-domain): a pathway for activation?
8573344 1995 Leukocyte integrins.
8458080 1993 A novel divalent cation-binding site in the A domain of the beta 2 integrin CR3 (CD11b/CD18) is essential for ligand binding.
8419480 1993 Structural analysis of the CD11b gene and phylogenetic analysis of the alpha-integrin gene family demonstrate remarkable conservation of genomic organization and suggest early diversification during evolution.
7867070 1995 Crystal structure of the A domain from the alpha subunit of integrin CR3 (CD11b/CD18).
4062888 1985 Isolation of complement-fragment-iC3b-binding proteins by affinity chromatography. The identification of p150,95 as an iC3b-binding protein.
3539202 1986 N-terminal sequence of human leukocyte glycoprotein Mo1: conservation across species and homology to platelet IIb/IIIa.
3284962 1988 Chromosomal location of the genes encoding the leukocyte adhesion receptors LFA-1, Mac-1 and p150,95. Identification of a gene cluster involved in cell adhesion.
2833753 1988 Molecular cloning of the alpha subunit of human and guinea pig leukocyte adhesion glycoprotein Mo1: chromosomal localization and homology to the alpha subunits of integrins.
2563162 1989 cDNA sequence for the alpha M subunit of the human neutrophil adherence receptor indicates homology to integrin alpha subunits.
2457584 1988 The human leukocyte adhesion glycoprotein Mac-1 (complement receptor type 3, CD11b) alpha subunit. Cloning, primary structure, and relation to the integrins, von Willebrand factor and factor B.
2454931 1988 Amino acid sequence of the alpha subunit of human leukocyte adhesion receptor Mo1 (complement receptor type 3).
1683702 1991 The promoter of the CD11b gene directs myeloid-specific and developmentally regulated expression.
1346576 1992 Characterization of the myeloid-specific CD11b promoter.