Property Summary

NCBI Gene PubMed Count 262
Grant Count 823
R01 Count 507
Funding $97,934,953.9
PubMed Score 3795.92
PubTator Score 2004.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession P11215 Q4VAK0 Q4VAK1 Q4VAK2
Symbols CR3A
MO1A
CD11B
MAC-1
MAC1A
SLEB6

Gene

PDB

4M76   1A8X   1BHO   1BHQ   1IDN   1IDO   1JLM   1M1U   1MF7   1N9Z   1NA5   2LKE   2LKJ   3Q3G   3QA3   4XW2  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1497 screening 501 / 0 / 92022 HTS identification of compounds inhibiting the binding of CD11b/CD18 to fibrinogen via a luminescence assay.
1499 screening 67 / 0 / 92623 HTS identification of compounds that enhance the binding of CD11b/CD18 to fibrinogen via a luminescence assay.
1644 summary 0 / 0 / 0 Summary of compounds inhibiting the binding of CD11b/CD18 to fibrinogen via a luminescence assay
1652 summary 0 / 0 / 0 Summary of compounds that enhance the binding of CD11b/CD18 to fibrinogen via a luminescence assay.

Gene RIF (225)

PMID Text
26852488 Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria
26512111 A novel expanding CD11b+ conventional dendritic cell subpopulation dominates the infiltrating renal inflammatory milieu, localizing to the glomeruli, in lupus nephritis.
26361072 While total surface expression of CD11b and L-selectin on neutrophils was largely unaffected
26309131 CD11b expression level might be considered a prognostic biomarker for Acute Myeloid Leukemia patients. [meta-analysis]
26306739 Data show that secreted aspartic protease 2 (Sap2) of Candida albicans inactivates human macrophage complement factor H (factor H), factor H-receptors CD11b/CD18 and CD11c/CD18.
26293614 There is direct interaction between C3(H2O) and CD11b. Contact-activated C3(H2O) is a novel ligand for CD11b/CD18 that mediates platelet-PMN complex formation and the binding of platelet-derived microparticles to PMNs.
26170143 study supports the crucial role of GABP in myeloid cell differentiation and identified ITGAM/CD11b as a novel GABP target gene
26036990 the results identify dynorphins A and B as novel ligands for Mac-1.
25971554 we confirmed the similarities between epithelial ovarian cancer and fallopian tube, normal and adenocarcinoma using FOLR1, FOLR2, CD68 and CD11b markers
25826119 analysis of neutrophil and monocyte expression of toll-like receptor 4, CD11b and reactive oxygen intermediates, and correlation with neuroimaging outcomes in preterm infants
More...

AA Sequence

MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQRGSLYQCDYST      1 - 70
GSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEA     71 - 140
LRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPN    141 - 210
PRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGV    211 - 280
IRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEM    281 - 350
SQEGFSAAITSNGPLLSTVGSYDWAGGVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLV    351 - 420
LGAPRYQHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAPHYYEQTRGGQ    421 - 490
VSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAIGAPGEEDNRGAVYLFHGTSG    491 - 560
SGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVDLTVGAQGHVLLLRSQPVLRVKAIMEFNPRE    561 - 630
VARNVFECNDQVVKGKEAGEVRVCLHVQKSTRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRR    631 - 700
QTQVLGLTQTCETLKLQLPNCIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNC    701 - 770
GNDNICQDDLSITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQ    771 - 840
RSWRLACESASSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKANVTSENNMPRT    841 - 910
NKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNLGQRSLPISLVFLVPVRLNQT    911 - 980
VIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVVNCSIAVCQRIQCDIPFFGIQEEFNATLKGN    981 - 1050
LSFDWYIKTSHNHLLIVSTAEILFNDSVFTLLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLL   1051 - 1120
ALITAALYKLGFFKRQYKDMMSEGGPPGAEPQ                                         1121 - 1152
//

Text Mined References (264)

PMID Year Title
27055590 2016 LFA-1 and Mac-1 integrins bind to the serine/threonine-rich domain of thrombomodulin.
26852488 2015 [Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria].
26512111 2015 RNA sensing by conventional dendritic cells is central to the development of lupus nephritis.
26361072 2015 Human neutrophil antigen-3a antibodies induce neutrophil stiffening and conformational activation of CD11b without shedding of L-selectin.
26309131 2015 Prognostic Value of CD11b Expression Level for Acute Myeloid Leukemia Patients: A Meta-Analysis.
26306739 2015 Secreted aspartic protease 2 of Candida albicans inactivates factor H and the macrophage factor H-receptors CR3 (CD11b/CD18) and CR4 (CD11c/CD18).
26293614 2015 Contact activation of C3 enables tethering between activated platelets and polymorphonuclear leukocytes via CD11b/CD18.
26170143 2015 The heteromeric transcription factor GABP activates the ITGAM/CD11b promoter and induces myeloid differentiation.
26036990 2015 The opioid peptide dynorphin A induces leukocyte responses via integrin Mac-1 (?M?2, CD11b/CD18).
25971554 2015 Expression of folate receptors alpha and beta in normal and cancerous gynecologic tissues: correlation of expression of the beta isoform with macrophage markers.
More...